Os01t0248900-01

Locus

Os01g0248900

Description

Alpha-expansin, Mediation of the cell extension and growth, Root system architecture

RAP-DB Gene Symbol Synonym(s)

EXPA8, OsEXPA8, OsEXP8, osaEXPa1.17

RAP-DB Gene Name Synonym(s)

ALPHA-EXPANSIN 8, Expansin-A8, Alpha-expansin-8

CGSNL Gene Symbol

EXPA8

CGSNL Gene Name

ALPHA-EXPANSIN 8

Oryzabase Gene Symbol Synonym(s)

OsEXPA8, OsEXP8, osaEXPa1.17

Oryzabase Gene Name Synonym(s)

Expansin-A8, Alpha-expansin-8

Transcript Evidence

AK111100

Protein Evidence

Q9XHX0

Literature

PMID: 24124527

Note

Manual Curation

December 13, 2016

Gene Ontology (GO)

Biological Process: plant-type cell wall organization (GO:0009664)

Cellular Component: extracellular region (GO:0005576)

Functional domain (InterPro)

Expansin/Lol pI (IPR007118)

Expansin (IPR002963)

RlpA-like protein, double-psi beta-barrel domain (IPR009009)

Expansin/pollen allergen, DPBB domain (IPR007112)

Expansin, cellulose-binding-like domain (IPR007117)

Full-length cDNA

002-175-G12 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0248900-01)

RiceXPro (AK111100)

Others

Oryzabase (13485)

KEGG (Os01t0248900-01)

Transcript

893 bp

>Os01t0248900-01 Alpha-expansin, Mediation of the cell extension and growth, Root system architecture
GACGCGACAATGGCGGCCGCCAGAATGCTCGTGCTCCTGGCCTCTCTCTGCGCTCTCCTG
CTCACGGCGTCCGCGGCCAAATGGACTCCTGCCTTCGCGACGTTCTACGGCGGCAGCGAC
GCCTCCGGCACCATGGGCGGCGCATGCGGGTACGGCGACCTGTACGGCGCCGGGTACGGG
ACGCGGACGGCGGCGCTGAGCACGGCGCTGTTCAACGGCGGCGCGTCGTGCGGCGCCTGC
TTCACCATCGCCTGCGACACCCGCAAGACGCAGTGGTGCAAGCCGGGGACGTCCATCACC
GTGACGGCGACCAACTTCTGCCCTCCAAACTACGCCCTGTCCGGCGACGCCGGCGGGTGG
TGCAACCCGCCGCGCCGCCACTTCGACATGTCGCAGCCGGCGTGGGAGACGATCGCGGTG
TACCGCGCCGGGATCGTGCCCGTGAACTACCGCCGCGTGCCGTGCCAGCGGAGCGGCGGC
ATCCGGTTCGCCGTGAACGGGCACAGCTACTTCGAGCTGGTGCTGGTGACGAACGTCGGC
GGCAGCGGCGCGGTGGCGCAGATGTGGATCAAGGGGTCCGGGACGGGGTGGATGGCGATG
AGCCGCAACTGGGGCGCGAACTGGCAGAGCAACGCGCGCCTCGACGGGCAGGCGCTGTCG
TTCCGGGTGCAGGccgacgacggccgcgtcgtcacggcggccgacgtcgcgccggcgggg
tggtcgttcggcgccacctacacctcctcgGCTCAGTTCTACTGATGAGCATTAATTGCA
AGCCTATCTCATTTAATTAATCTGGACCGTTCGATGTAGTATATTGTATGCTTTGATCGA
CGTGGCATAGGATGGAAGAGGCCGCCCACGAAGAAAATTTGGGACTTGTGTAT

CDS

756 bp

>Os01t0248900-01 Alpha-expansin, Mediation of the cell extension and growth, Root system architecture
ATGGCGGCCGCCAGAATGCTCGTGCTCCTGGCCTCTCTCTGCGCTCTCCTGCTCACGGCG
TCCGCGGCCAAATGGACTCCTGCCTTCGCGACGTTCTACGGCGGCAGCGACGCCTCCGGC
ACCATGGGCGGCGCATGCGGGTACGGCGACCTGTACGGCGCCGGGTACGGGACGCGGACG
GCGGCGCTGAGCACGGCGCTGTTCAACGGCGGCGCGTCGTGCGGCGCCTGCTTCACCATC
GCCTGCGACACCCGCAAGACGCAGTGGTGCAAGCCGGGGACGTCCATCACCGTGACGGCG
ACCAACTTCTGCCCTCCAAACTACGCCCTGTCCGGCGACGCCGGCGGGTGGTGCAACCCG
CCGCGCCGCCACTTCGACATGTCGCAGCCGGCGTGGGAGACGATCGCGGTGTACCGCGCC
GGGATCGTGCCCGTGAACTACCGCCGCGTGCCGTGCCAGCGGAGCGGCGGCATCCGGTTC
GCCGTGAACGGGCACAGCTACTTCGAGCTGGTGCTGGTGACGAACGTCGGCGGCAGCGGC
GCGGTGGCGCAGATGTGGATCAAGGGGTCCGGGACGGGGTGGATGGCGATGAGCCGCAAC
TGGGGCGCGAACTGGCAGAGCAACGCGCGCCTCGACGGGCAGGCGCTGTCGTTCCGGGTG
CAGGccgacgacggccgcgtcgtcacggcggccgacgtcgcgccggcggggtggtcgttc
ggcgccacctacacctcctcgGCTCAGTTCTACTGA

Protein

252 aa

>Os01t0248900-01 Alpha-expansin, Mediation of the cell extension and growth, Root system architecture
MAAARMLVLLASLCALLLTASAAKWTPAFATFYGGSDASGTMGGACGYGDLYGAGYGTRT
AALSTALFNGGASCGACFTIACDTRKTQWCKPGTSITVTATNFCPPNYALSGDAGGWCNP
PRRHFDMSQPAWETIAVYRAGIVPVNYRRVPCQRSGGIRFAVNGHSYFELVLVTNVGGSG
AVAQMWIKGSGTGWMAMSRNWGANWQSNARLDGQALSFRVQADDGRVVTAADVAPAGWSF
GATYTSSAQFY*

5'UTR

chr01:8197088..8197096 (- strand) : 9 bp

CDS

chr01:8196961..8197087 (- strand) : 127 bp

chr01:8196211..8196839 (- strand) : 629 bp

3'UTR

chr01:8196083..8196210 (- strand) : 128 bp

FASTA

>Os01t0248900-01 class=Sequence position=chr01:8196083..8197096 (- strand)
GACGCGACAA TGGCGGCCGC CAGAATGCTC GTGCTCCTGG CCTCTCTCTG CGCTCTCCTG CTCACGGCGT CCGCGGCCAA
ATGGACTCCT GCCTTCGCGA CGTTCTACGG CGGCAGCGAC GCCTCCGGCA CCATGGGTTA GTAGCAAATT AAGCTCAGCT
AATCACCATG CATGTGTTAA TTAATCTTTT GCAAAGTTTA ATTGGCATTT ACAATAATGG AGTTTGGTCT CTCTCTCGTC
TCGTGTGTGA TATCCAGGCG GCGCATGCGG GTACGGCGAC CTGTACGGCG CCGGGTACGG GACGCGGACG GCGGCGCTGA
GCACGGCGCT GTTCAACGGC GGCGCGTCGT GCGGCGCCTG CTTCACCATC GCCTGCGACA CCCGCAAGAC GCAGTGGTGC
AAGCCGGGGA CGTCCATCAC CGTGACGGCG ACCAACTTCT GCCCTCCAAA CTACGCCCTG TCCGGCGACG CCGGCGGGTG
GTGCAACCCG CCGCGCCGCC ACTTCGACAT GTCGCAGCCG GCGTGGGAGA CGATCGCGGT GTACCGCGCC GGGATCGTGC
CCGTGAACTA CCGCCGCGTG CCGTGCCAGC GGAGCGGCGG CATCCGGTTC GCCGTGAACG GGCACAGCTA CTTCGAGCTG
GTGCTGGTGA CGAACGTCGG CGGCAGCGGC GCGGTGGCGC AGATGTGGAT CAAGGGGTCC GGGACGGGGT GGATGGCGAT
GAGCCGCAAC TGGGGCGCGA ACTGGCAGAG CAACGCGCGC CTCGACGGGC AGGCGCTGTC GTTCCGGGTG CAGGccgacg
acggccgcgt cgtcacggcg gccgacgtcg cgccggcggg gtggtcgttc ggcgccacct acacctcctc gGCTCAGTTC
TACTGATGAG CATTAATTGC AAGCCTATCT CATTTAATTA ATCTGGACCG TTCGATGTAG TATATTGTAT GCTTTGATCG
ACGTGGCATA GGATGGAAGA GGCCGCCCAC GAAGAAAATT TGGGACTTGT GTAT

Locus: Os01g0248900

Loading...

Locus: Os01g0248900

Loading...