Os01t0259900-00

Locus

Os01g0259900

Description

Homolog of SAD1 (RNA polymerase I subunit A34.5)

RAP-DB Gene Symbol Synonym(s)

SAD1L

RAP-DB Gene Name Synonym(s)

SAD1LIKE

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

SAD1L

Oryzabase Gene Name Synonym(s)

SAD1LIKE

Transcript Evidence

AK333514

Protein Evidence

NP_001042641.2 (RefSeq)

Literature

PMID: 25404280

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

January 7, 2021

Expression Databases

TENOR (Os01t0259900-00)

Others

Oryzabase (18690)

Transcript

792 bp

>Os01t0259900-00 Homolog of SAD1 (RNA polymerase I subunit A34.5)
TTTATTTTTAACTTTGCTGCAACCAACCATTGTAGCTATGAGCCTGGACCAGCATTTGAG
GAGAACAGCGAAGAGGCTATGCTTGACATATCACAAACAGAGTCAACGGAACTTTGGCTA
ATACAGTGGCCTCTAAATCAGTTAGATGCGTCTGATTTTCATGGTCAAGAACTTACTCTT
AAGTTGCACCGTGATGGAAAATTGAGCAGTTTGGAGAGTTCCTCGGGGAAGTCTTATGAT
CTTGTCAGCTTTGCTGCTCAGCAACCAGATGCAACTGTTTTCCTTCCATCCGGACCAGAA
GCAAAAGCTGTTGGGAAGATTGCACGTCGAGTTAGCTTAGTTCGTTATCCTGACCCTGAA
GAACTGGAGAAGCCAGGTTTGGGGAGTCTCACTCCTAGCAGTAAGAAATCTGCAGTTGCT
CTCACTGATCTGAATTTGTCCGGTCTTCCAGGTTCTTCAAAGAAGACGAGGTCTCGGTTC
ACTAGCGGGTCGAAGAACCGCAGCAGCCAAGGCTCAGCGCAATCGCTGGGCCAACAGAGT
GCCGAGCCCGCGCACAAGCACAATCAGAAGAGAAAGGATGAGAGCAGTTTGGGGCACTCG
AATGTATCGGGCAAGTCGGCCGAAGGATCCCAGGTTCGTGGTGGCGACAGCGGCACGACC
TCGGAGGTTCCTCAGACGCCTGTGGAGAAATCCAAGAAGAAGAACAAGAAGGTTAGGATC
GCCGAGTAAGCAGTATCATCGTAGCTCAGGGGGTCAGGAGAAGAGAGGTTAATTTTCCCT
GAACTGTCAGCA

CDS

729 bp

>Os01t0259900-00 Homolog of SAD1 (RNA polymerase I subunit A34.5)
TTTATTTTTAACTTTGCTGCAACCAACCATTGTAGCTATGAGCCTGGACCAGCATTTGAG
GAGAACAGCGAAGAGGCTATGCTTGACATATCACAAACAGAGTCAACGGAACTTTGGCTA
ATACAGTGGCCTCTAAATCAGTTAGATGCGTCTGATTTTCATGGTCAAGAACTTACTCTT
AAGTTGCACCGTGATGGAAAATTGAGCAGTTTGGAGAGTTCCTCGGGGAAGTCTTATGAT
CTTGTCAGCTTTGCTGCTCAGCAACCAGATGCAACTGTTTTCCTTCCATCCGGACCAGAA
GCAAAAGCTGTTGGGAAGATTGCACGTCGAGTTAGCTTAGTTCGTTATCCTGACCCTGAA
GAACTGGAGAAGCCAGGTTTGGGGAGTCTCACTCCTAGCAGTAAGAAATCTGCAGTTGCT
CTCACTGATCTGAATTTGTCCGGTCTTCCAGGTTCTTCAAAGAAGACGAGGTCTCGGTTC
ACTAGCGGGTCGAAGAACCGCAGCAGCCAAGGCTCAGCGCAATCGCTGGGCCAACAGAGT
GCCGAGCCCGCGCACAAGCACAATCAGAAGAGAAAGGATGAGAGCAGTTTGGGGCACTCG
AATGTATCGGGCAAGTCGGCCGAAGGATCCCAGGTTCGTGGTGGCGACAGCGGCACGACC
TCGGAGGTTCCTCAGACGCCTGTGGAGAAATCCAAGAAGAAGAACAAGAAGGTTAGGATC
GCCGAGTAA

Protein

243 aa

>Os01t0259900-00 Homolog of SAD1 (RNA polymerase I subunit A34.5)
FIFNFAATNHCSYEPGPAFEENSEEAMLDISQTESTELWLIQWPLNQLDASDFHGQELTL
KLHRDGKLSSLESSSGKSYDLVSFAAQQPDATVFLPSGPEAKAVGKIARRVSLVRYPDPE
ELEKPGLGSLTPSSKKSAVALTDLNLSGLPGSSKKTRSRFTSGSKNRSSQGSAQSLGQQS
AEPAHKHNQKRKDESSLGHSNVSGKSAEGSQVRGGDSGTTSEVPQTPVEKSKKKNKKVRI
AE*

CDS

chr01:8718704..8718844 (+ strand) : 141 bp

chr01:8718931..8719015 (+ strand) : 85 bp

chr01:8719632..8719715 (+ strand) : 84 bp

chr01:8719969..8720073 (+ strand) : 105 bp

chr01:8720585..8720898 (+ strand) : 314 bp

3'UTR

chr01:8720899..8720961 (+ strand) : 63 bp

FASTA

>Os01t0259900-00 class=Sequence position=chr01:8718704..8720961 (+ strand)
TTTATTTTTA ACTTTGCTGC AACCAACCAT TGTAGCTATG AGCCTGGACC AGCATTTGAG GAGAACAGCG AAGAGGCTAT
GCTTGACATA TCACAAACAG AGTCAACGGA ACTTTGGCTA ATACAGTGGC CTCTAAATCA GGTTATGCGG ATATTATTTT
CATTATGTGC CAGGTGGCAT GCTGCACAAG GGATCTCGAA TTTAACGTTT TTCTGTGTTG CATGCAGTTA GATGCGTCTG
ATTTTCATGG TCAAGAACTT ACTCTTAAGT TGCACCGTGA TGGAAAATTG AGCAGTTTGG AGAGTTCCTC GGGTAAGATA
TATTCGATGA ACTATGTTGC ACCTGATCGA TTATGTCTTT TGAAGGTTTT TCAGCTTTCT GTACAGTCGG ATTGGATGCA
ACCTGTATTT GCTCATGCAA TCACACTTTG ACCTTATTGA TTAGTTTTTC CCAAAGTGGG CACCTAGACT TCTCATTACT
AATCCCAAAC AATGTTAATC CTATCAATGG AACTGCTTCC ATTTCTATGG TCAAGCTTGC CTCTCATTTT TGTATGAAGA
TGAAGTCAAT GCTGGTTCAT TGATGACTAG TAGTGTTTTG CAGATCTTTA GGCAACAAAT GAACAAATGG AATTAAGGTG
CTATAATTTA GTTTACATAT AGAAGTTTTT ATGTTTAGTG TATGTTCAGA AGTTTGATTG GTGAAGTGAA ATCTGCTCTC
AGCTTCCTCG TATAATAATC CGTGATTTGA AGCTAGAATG ATAACATTCA TCAGTAAGAC TACTAGCAGT AGGCTACTAG
GTTTTCTAAC TTCTTTTTCT TGGTTAAGAT CGTCAGTTCG TCGCTTTTAA ATTATTGTGG CAATAACAAT TTAAATTTTA
AAGTTCTCCC AAAAGTTTGA GCTGTACTTG TTATACTTAA TTTGGCAGGG AAGTCTTATG ATCTTGTCAG CTTTGCTGCT
CAGCAACCAG ATGCAACTGT TTTCCTTCCA TCCGGACCAG AAGCAAAAGC TGGTATGCTG AAATACCAAC TTTGCAGTTT
ATTTCTGCAG TATTTTACTA TTTTGCATGG ATGTTGTTTT TACTTGTTAT CGGTCTTGTT AAATTGAGCT GTTTGTTGAC
CTATTTGATT TTGTGATTTT GGTCGTGCTT GATAGCACAA TCGGTAGAAC ACATCTATCA TTTCTTCCTT TCCTGGGAGG
CAGCTAATAT TGTTCTTTTA ACTTACTGTA TGCATATTGT TCTTTTAATC CTAAAAAAAT TCCAGTTGGG AAGATTGCAC
GTCGAGTTAG CTTAGTTCGT TATCCTGACC CTGAAGAACT GGAGAAGCCA GGTTTGGGGA GTCTCACTCC TAGCAGTAAG
AAATCTGCAG GTGAGTACAT TTTCTCAGGC ATCTTTTTAT AATGATGCCA CTCTTCTGCT GTCTATGGTG AATGTATTAT
ATAGACTTGA CAAGCATGAT ATGCCATTCC ATTTGAACTA GTCAATAACT TAGACTTGTG TAGGTTTAGC CTCCTGTTTT
AACTAGAAAT CCAGTATCAC CAGATTTAAC TTTGTAAGTG CATATTACTG TTCAATCTTT TCACATTGAC AGTAATGAGG
TGATGAACAT ACTATTTGTC TTAAGATTTT TGGGCACCAT TGAAAGTTGA CATTAGCCAA ATTCCTGATA TATATTATTG
AAGACTCATG CCAATGATGC AATGCATGCT CTTGTATTAT AAGATGGAAG AACTGTTCTG AGAGAGAAAT ACTAAGCTCA
TCTCTGTAGT TTCTATTTCT GTTGGTTAAG GTATGCACTT TCAATTAATA AAGGTTTCCA GCCAACAGCT GAAGTGTTTT
CTCTTTTTCT ATCATAAACA GAACACTTTG GTAAACAGTA GTTGCTCTCA CTGATCTGAA TTTGTCCGGT CTTCCAGGTT
CTTCAAAGAA GACGAGGTCT CGGTTCACTA GCGGGTCGAA GAACCGCAGC AGCCAAGGCT CAGCGCAATC GCTGGGCCAA
CAGAGTGCCG AGCCCGCGCA CAAGCACAAT CAGAAGAGAA AGGATGAGAG CAGTTTGGGG CACTCGAATG TATCGGGCAA
GTCGGCCGAA GGATCCCAGG TTCGTGGTGG CGACAGCGGC ACGACCTCGG AGGTTCCTCA GACGCCTGTG GAGAAATCCA
AGAAGAAGAA CAAGAAGGTT AGGATCGCCG AGTAAGCAGT ATCATCGTAG CTCAGGGGGT CAGGAGAAGA GAGGTTAATT
TTCCCTGAAC TGTCAGCA

Locus: Os01g0259900

Loading...

Locus: Os01g0259900

Loading...