Os01t0261200-01

Locus

Os01g0261200

Description

NAC transcription factor, Heat stress tolerance

RAP-DB Gene Symbol Synonym(s)

OsNTL3

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

NAC8

CGSNL Gene Name

NAC DOMAIN-CONTAINING PROTEIN 8

Oryzabase Gene Symbol Synonym(s)

OsNAC8, ONAC074, ONAC74, NAC74, OsNAC8/ONAC074, OsNTL3, NTL3

Oryzabase Gene Name Synonym(s)

OsNAC8 protein, NAC domain-containing protein 8, NAC domain-containing protein 074, NAC domain-containing protein 74, NAC membrane-bound transcription factor 3, NAC MTF3

Transcript Evidence

AK102808

Protein Evidence

Q7GCL7

Literature

PMID: 31733092

PMID: 10660065

Note

Manual Curation

November 18, 2019

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-templated (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Functional domain (InterPro)

NAC domain superfamily (IPR036093)

NAC domain (IPR003441)

Experimentally confirmed subcellular location

plasma membrane (GO:0005886)

nucleus (GO:0005634) [heat stress]

Full-length cDNA

J033108J08 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0261200-01)

RiceXPro (AK102808)

Others

Oryzabase (6235)

KEGG (Os01t0261200-01)

Transcript

1996 bp

>Os01t0261200-01 NAC transcription factor, Heat stress tolerance
ACCCATCCATCCCTAGCTTCCTCGCTGCTTCGCCCGCCACGTCACCCTCCTCCTCCTCCC
CTTTTTTTTCTCTCGCTCGCCTCGCCATCCATGGCGTCGATGGCGAACCAGCAGTAGTAG
TAGTCCACCCCAACGACGCGCGCGAGCCAGCTCCGGGGTACCCGCCGCTCGTGCCCGGGG
GGGAAGGGGGTGCACCGGGGAGCCGTCGCGCCGCGCGGCTCTGATTCTTCCCGTTCCCGG
AGATTTGAACCATGGAGTCTTTACGTGACATGGTCCTCCCACCAGGATTTGGATTCCACC
CAAAAGATACTGAGCTCATTTCTCACTATCTGAAAAAGAAAATACATGGCCAAAAGATTG
AATATGAGATCATTCCAGAGGTGGATATATACAAGCATGAACCATGGGATTTACCTGCAA
AGTGCGATGTTCCAACTCAGGATAATAAGTGGCATTTCTTCGCTGCTCGTGACAGAAAGT
ATCCTAACGGTTCTCGGTCAAATAGGGCAACAGTTGCTGGGTATTGGAAATCCACTGGAA
AGGATCGAGCCATAAAAATGGGCAAGCAAACTATAGGAACGAAGAAAACTTTAGTTTTTC
ATGAAGGCCGCCCACCCACTGGGAGACGTACTGAGTGGATCATGCATGAGTACTATATAG
ATGAGCGTGAATGTCAAGCCTGCCCTGATATGAAGGATGCATATGTACTTTGTCGTATTA
CCAAAAGAAATGACTGGATCCCAGGGAATGGCAATGAGTTGGACAACAGTGATCCTCATC
CAGAACCATATGATGCTCCTCCATCAGTTATCAGTACTGAACAGCTAAATCCTGCTGCTG
AACCAGTTGTCGGTGTTGAAGCTGCACCAGTTACCGTTGCTGAACCTGACGGTGTTACTA
CGTCAGCTATCACTGCTAATATACCATCTCCTAGTGATGACATTAATCTGGATGATTGGT
TGAATGAACTATTTGATCCTTTCTTTGACCCTGAACAGAGTCTGGCTTCTGCTGATCTGT
CTCCAGATGAACAAAATGTTGAATCATCGAACGTAGGTGCTTTGGCTCCAAAGGTGGAAC
AAGACTATTCTAGTCCTAACGAGAACGTAGTAGATGATACGGAGTACTTGTTGCCTGAAG
ATGTTTACAACATACTGCACCCTGGTACAGATGACTTCAATATGCTCCAGAATCCTTTGG
ATCAGTACCCCATTCAATATGCAACCGATGTTTGGAGTGGAATTCAGAAGGAAGAACTGT
GGTCGCCCCAGGCCAATGCTGAGCCTAGTCAGTCGAATGAAGCTGCTGATAATGGAATTA
TAAGACGTTATCGTAGTATGAAAACACCTGAAACTAGTGTGCCGCAGTTCAAGGGTAAAA
CTCAGGCTAAAATGCGGGTTGGGATCAACAAGATGGCTACGAGTAGTTCTGAATCTATCA
ACCAGACTATCAAGTTTGAGAACAGTGGTCGTCTTGTTGAGCACCAGAAGAACCAAGCGC
ATGATGTAGCTTCTACCAAGCGGTCAGACGCAGGGAAGCCAAGTACAGAGCTCAGCAGCA
ATCGAGGATTTCTCAGGGGTATCCGAAATGCATTTGCAGGCTGTTCGGATGCTCGATGGA
ACATGATACTTGTTGCGGGTTTCGCTATTGGAGTCGCTGTGGTAGCGCTTCATATAGGCC
AACGCCTTGGATTAAGCCAGAGAGATCAGCAGCATACCTAGCCTTTAGGTTTGCAGGTTA
CTGGGTTTCTATGCTTTTTGCAATCTGGAGAAACGTAAACAAACTCCGATCTTTGGTTGG
TGCAGAACATTTGATGTATGCGCCGTTTTTTTTGTGTTGGTTTTGTACATATTATTATCT
TCGGTTTTGGTCGACTTTTGTTCTCGCCAGCTAGTAGTACTATGTTGACGAATGTAGAAG
AAAACCTCAAAAAAAAAAGAACAAATGAAAAAAAATTGACGATGAAAATTTATATAATTA
ACCGCTTGCATTGTAC

CDS

1470 bp

>Os01t0261200-01 NAC transcription factor, Heat stress tolerance
ATGGAGTCTTTACGTGACATGGTCCTCCCACCAGGATTTGGATTCCACCCAAAAGATACT
GAGCTCATTTCTCACTATCTGAAAAAGAAAATACATGGCCAAAAGATTGAATATGAGATC
ATTCCAGAGGTGGATATATACAAGCATGAACCATGGGATTTACCTGCAAAGTGCGATGTT
CCAACTCAGGATAATAAGTGGCATTTCTTCGCTGCTCGTGACAGAAAGTATCCTAACGGT
TCTCGGTCAAATAGGGCAACAGTTGCTGGGTATTGGAAATCCACTGGAAAGGATCGAGCC
ATAAAAATGGGCAAGCAAACTATAGGAACGAAGAAAACTTTAGTTTTTCATGAAGGCCGC
CCACCCACTGGGAGACGTACTGAGTGGATCATGCATGAGTACTATATAGATGAGCGTGAA
TGTCAAGCCTGCCCTGATATGAAGGATGCATATGTACTTTGTCGTATTACCAAAAGAAAT
GACTGGATCCCAGGGAATGGCAATGAGTTGGACAACAGTGATCCTCATCCAGAACCATAT
GATGCTCCTCCATCAGTTATCAGTACTGAACAGCTAAATCCTGCTGCTGAACCAGTTGTC
GGTGTTGAAGCTGCACCAGTTACCGTTGCTGAACCTGACGGTGTTACTACGTCAGCTATC
ACTGCTAATATACCATCTCCTAGTGATGACATTAATCTGGATGATTGGTTGAATGAACTA
TTTGATCCTTTCTTTGACCCTGAACAGAGTCTGGCTTCTGCTGATCTGTCTCCAGATGAA
CAAAATGTTGAATCATCGAACGTAGGTGCTTTGGCTCCAAAGGTGGAACAAGACTATTCT
AGTCCTAACGAGAACGTAGTAGATGATACGGAGTACTTGTTGCCTGAAGATGTTTACAAC
ATACTGCACCCTGGTACAGATGACTTCAATATGCTCCAGAATCCTTTGGATCAGTACCCC
ATTCAATATGCAACCGATGTTTGGAGTGGAATTCAGAAGGAAGAACTGTGGTCGCCCCAG
GCCAATGCTGAGCCTAGTCAGTCGAATGAAGCTGCTGATAATGGAATTATAAGACGTTAT
CGTAGTATGAAAACACCTGAAACTAGTGTGCCGCAGTTCAAGGGTAAAACTCAGGCTAAA
ATGCGGGTTGGGATCAACAAGATGGCTACGAGTAGTTCTGAATCTATCAACCAGACTATC
AAGTTTGAGAACAGTGGTCGTCTTGTTGAGCACCAGAAGAACCAAGCGCATGATGTAGCT
TCTACCAAGCGGTCAGACGCAGGGAAGCCAAGTACAGAGCTCAGCAGCAATCGAGGATTT
CTCAGGGGTATCCGAAATGCATTTGCAGGCTGTTCGGATGCTCGATGGAACATGATACTT
GTTGCGGGTTTCGCTATTGGAGTCGCTGTGGTAGCGCTTCATATAGGCCAACGCCTTGGA
TTAAGCCAGAGAGATCAGCAGCATACCTAG

Protein

490 aa

>Os01t0261200-01 NAC transcription factor, Heat stress tolerance
MESLRDMVLPPGFGFHPKDTELISHYLKKKIHGQKIEYEIIPEVDIYKHEPWDLPAKCDV
PTQDNKWHFFAARDRKYPNGSRSNRATVAGYWKSTGKDRAIKMGKQTIGTKKTLVFHEGR
PPTGRRTEWIMHEYYIDERECQACPDMKDAYVLCRITKRNDWIPGNGNELDNSDPHPEPY
DAPPSVISTEQLNPAAEPVVGVEAAPVTVAEPDGVTTSAITANIPSPSDDINLDDWLNEL
FDPFFDPEQSLASADLSPDEQNVESSNVGALAPKVEQDYSSPNENVVDDTEYLLPEDVYN
ILHPGTDDFNMLQNPLDQYPIQYATDVWSGIQKEELWSPQANAEPSQSNEAADNGIIRRY
RSMKTPETSVPQFKGKTQAKMRVGINKMATSSSESINQTIKFENSGRLVEHQKNQAHDVA
STKRSDAGKPSTELSSNRGFLRGIRNAFAGCSDARWNMILVAGFAIGVAVVALHIGQRLG
LSQRDQQHT*

5'UTR

chr01:8797117..8797358 (- strand) : 242 bp

chr01:8796164..8796172 (- strand) : 9 bp

CDS

chr01:8795998..8796163 (- strand) : 166 bp

chr01:8795341..8795618 (- strand) : 278 bp

chr01:8794537..8794890 (- strand) : 354 bp

chr01:8792925..8793596 (- strand) : 672 bp

3'UTR

chr01:8792650..8792924 (- strand) : 275 bp

FASTA

>Os01t0261200-01 class=Sequence position=chr01:8792650..8797358 (- strand)
ACCCATCCAT CCCTAGCTTC CTCGCTGCTT CGCCCGCCAC GTCACCCTCC TCCTCCTCCC CTTTTTTTTC TCTCGCTCGC
CTCGCCATCC ATGGCGTCGA TGGCGAACCA GCAGTAGTAG TAGTCCACCC CAACGACGCG CGCGAGCCAG CTCCGGGGTA
CCCGCCGCTC GTGCCCGGGG GGGAAGGGGG TGCACCGGGG AGCCGTCGCG CCGCGCGGCT CTGATTCTTC CCGTTCCCGG
AGGTGAGTGG GTTGACTGAC TCCTCCCCGC TCCGCGCCGC GCCGCGACTG GCCTCGACTC TGCGTGTGTG TTTGGTTAGG
TGATTTGGAT TGTTCCGCGC TTGACGACGT CCCCGCTCGT TGTTGGGGGG TTTCGTCTTG GTGCGGGGGA TTTTTTTGTT
GTTTAGCGTT CGTTCATGTT AGGGGTAGTT GTTTCGTCTC GTCTCGGGAG GTGGGGGGTT TTAGGGTGAT TCTTCGATCG
AGATCTTCGT TTAGGGGTTG CGATCACTCG CCGATTGCGG ATCTTTGCCG CGGAATTTTT CTTATTCTTT TTTTTTTTTT
TGCCTCCTGG GGTTTTCGAT TCGGGGGGCA GATTCTTGGG GGATTCGAGA CGCGCGTAAT GGGGATTGGT TGCGACCCCG
TCGAAATCCG AGTGGATCGG TCGGTTGGTT GGTTGTGCGA AGAAATGGTG TTCTTGAAGT AGTTCGGTAT TTGGGGAATT
AGGATAGCTG CTCTTCCTTC AGTGCTTCAA TAGGATGATA AATCAGTGAA TTCCCGATTG TTTTTTCTTT TCCCATTTTA
GCTAGCCTAT AATAGGATAT CACCCCACTT TTCAGGTGGT TTAATGTGAA ATTTGGAGTT ATTACCATAT TCCTACTAAT
CATTTTAGAA TTTCCTCCCC TGCTTGCTTT GAACCTGAAA TTGTCAATAA TTAGAAAGGA GGAAGCATCA TTGTTCATAT
GGATTTTTGT TAGTTTGCCT CCATGTTTAT CTTCTGTAAA ATGCTTGGGG ATGTTACTCC ATGAGCATAC TAAAATCGCC
AACGTTTGTG TTGAGAATCT TTCTAGAAAG ATTTATAAGA TCGTCACTTA TGTTCTTTAG TTTTTAGGCA GTAAGTCGTT
GTGCTAAATA CCCATGCCGT TTTAGATTCT CCCTGATCAT GTTTGCTTTT CTTGATTCAT GCACAGATTT GAACCATGGA
GTCTTTACGT GACATGGTCC TCCCACCAGG ATTTGGATTC CACCCAAAAG ATACTGAGCT CATTTCTCAC TATCTGAAAA
AGAAAATACA TGGCCAAAAG ATTGAATATG AGATCATTCC AGAGGTGGAT ATATACAAGC ATGAACCATG GGATTTACCT
GGTAAGTTGA ACATTATTCC ATGACAACCT ATATTTGTTT CGTTCCATAG AGTTTGCTGA TGAGAAAAGA GTCAATATTT
GACCATCAAT TTAAACTAGA TAATGCTGGT AGATGGAAAC ATTCATGTTT GCAAGAACCA CTGGGGAATG CACCAGAATG
TTTTCTGTAT TCTTAGTACT GTTGTCATTT CTTAGTACTG TTGCATCCTT TGCCTTTTTA AATATTATGC AACTGATTGC
CAATTATGTA TCTTCTTTGT CCAATTCTCT GCCCTGTTAT TTTGATAGAT GAGTTTCTTT TTTCTACTTT TTGGCTTCCT
TTGTTTGTAT GCCGCTTGGA ATCTAATTAT GTAAACTGCT GATGATATTT CACATTACAG CAAAGTGCGA TGTTCCAACT
CAGGATAATA AGTGGCATTT CTTCGCTGCT CGTGACAGAA AGTATCCTAA CGGTTCTCGG TCAAATAGGG CAACAGTTGC
TGGGTATTGG AAATCCACTG GAAAGGATCG AGCCATAAAA ATGGGCAAGC AAACTATAGG AACGAAGAAA ACTTTAGTTT
TTCATGAAGG CCGCCCACCC ACTGGGAGAC GTACTGAGTG GATCATGCAT GAGTACTATA TAGATGAGCG TGAATGTCAA
GCCTGCCCTG ATATGAAGGT ATTGAACTAA TTATTAAGAT TTTAAAGTGG CTTATTTAGA AAAGAGAGAA CTATATTGTG
GCTTTACATG Atactccctc cgtttcaaaa tatttgacac cgttgacttt ttagtacgtg tttgactatt cgtcttattc
aaaaaattta agtaattatt tattcttttc atatcatttg attcattgtt aaatatactt tcatgtacac atatagtttt
acatatttca caaatttttt ttaataagac gaacggttaa acatgtgcta aaaaatcaac ggtgtcaaac attttgaaac
ggagggagta TATAAATTAA TGTGCACTGT ACCTTCTTGA TGTCACTCTT CAAACAACTT GCTGGTTTAG ATGATATAAT
CATATGATTT GCTGACTAAG GGCGAATTCC AGTATCTAAT GTAGGGCTTT TATTTTATTG TCCCTCAGGA TGCATATGTA
CTTTGTCGTA TTACCAAAAG AAATGACTGG ATCCCAGGGA ATGGCAATGA GTTGGACAAC AGTGATCCTC ATCCAGAACC
ATATGATGCT CCTCCATCAG TTATCAGTAC TGAACAGCTA AATCCTGCTG CTGAACCAGT TGTCGGTGTT GAAGCTGCAC
CAGTTACCGT TGCTGAACCT GACGGTGTTA CTACGTCAGC TATCACTGCT AATATACCAT CTCCTAGTGA TGACATTAAT
CTGGATGATT GGTTGAATGA ACTATTTGAT CCTTTCTTTG ACCCTGAACA GAGTCTGGCT TCTGCTGATC TGTCTCCAGA
TGAACAAAAT GTTGAATCAT CGGTGAGTTT CTTCACAGTC ACTGTGTTTG CAGGTTAAAT AATTCAATGG ATAAATTATT
AGAATGTTGT AGTGACATTA TTAGAATGTT GTAGTGACTC CAGCTCCCTA TGAGAACGGG CTATTGCATG AACAAGAATC
TGTTGGACAA ATCTAACATG CTTGTTACTC ATAATAAATT GATCTTCACT GGTCCACTTG TGCATACTGA TTGCTATTTA
ATATATCTGC ATAATGCATT TCTGATAGAC AAAATACTGA ATAACTTCAC GAACATATAG AAACCAAACA CAACATTGCA
TTATAGTAAT GTTTGTGAGC CTAGTACAGC ACTGGTTACT GCTTGGGAAT TGATACTAAG CCTAGTACAG CACTGGTTAC
TGCTTGGGAA TTGATACTAA TATGAAGCAT GTGACTGGTA ATGACCTTTA GAGATACCTA GACATAGGCA AATCACAATG
TTGTGACCAT TTTTTTTTGT GACTTAGTAT GGCTGCCCTT TTATTTTCTT TTGCTGGTTG ACAAAGAAGA TTTGCTTGTA
ATTTTTTTAG GAACACCGGA GTAATGCATT CTCATGGATA ATATTTGAAA CTCATTGAAA ATTATTATGA TTTGTTTGGA
TTGACTTTTT AAAAAATAGC CATGATTTGC ATATACCATG GACTGAAGCT ATCTTATGTG TTACGGTTTG TTCCACCTCT
TCTGAGATTT CTGGTTATTG CCAAGTATCT GGTCTGTTAT ATTATGGGGA AACGTTGACT GTAGTTGTGT TTTCATACCA
TGTTCTTTCT TTAACACGGA ACCTAGGAGT CAATGTATTT TCTGCAAATC ATGAATTGTA CTTGTCATTG TGCTGTGCAT
TCTGCCATTC TACTATGTTT TGATTGCAGT TCTTAGCCTG TGCATACTTG CTCATCGCGC TATCTTCCTT CTTAATTTAC
AGAACGTAGG TGCTTTGGCT CCAAAGGTGG AACAAGACTA TTCTAGTCCT AACGAGAACG TAGTAGATGA TACGGAGTAC
TTGTTGCCTG AAGATGTTTA CAACATACTG CACCCTGGTA CAGATGACTT CAATATGCTC CAGAATCCTT TGGATCAGTA
CCCCATTCAA TATGCAACCG ATGTTTGGAG TGGAATTCAG AAGGAAGAAC TGTGGTCGCC CCAGGCCAAT GCTGAGCCTA
GTCAGTCGAA TGAAGCTGCT GATAATGGAA TTATAAGACG TTATCGTAGT ATGAAAACAC CTGAAACTAG TGTGCCGCAG
TTCAAGGGTA AAACTCAGGC TAAAATGCGG GTTGGGATCA ACAAGATGGC TACGAGTAGT TCTGAATCTA TCAACCAGAC
TATCAAGTTT GAGAACAGTG GTCGTCTTGT TGAGCACCAG AAGAACCAAG CGCATGATGT AGCTTCTACC AAGCGGTCAG
ACGCAGGGAA GCCAAGTACA GAGCTCAGCA GCAATCGAGG ATTTCTCAGG GGTATCCGAA ATGCATTTGC AGGCTGTTCG
GATGCTCGAT GGAACATGAT ACTTGTTGCG GGTTTCGCTA TTGGAGTCGC TGTGGTAGCG CTTCATATAG GCCAACGCCT
TGGATTAAGC CAGAGAGATC AGCAGCATAC CTAGCCTTTA GGTTTGCAGG TTACTGGGTT TCTATGCTTT TTGCAATCTG
GAGAAACGTA AACAAACTCC GATCTTTGGT TGGTGCAGAA CATTTGATGT ATGCGCCGTT TTTTTTGTGT TGGTTTTGTA
CATATTATTA TCTTCGGTTT TGGTCGACTT TTGTTCTCGC CAGCTAGTAG TACTATGTTG ACGAATGTAG AAGAAAACCT
CAAAAAAAAA AGAACAAATG AAAAAAAATT GACGATGAAA ATTTATATAA TTAACCGCTT GCATTGTAC

Locus: Os01g0261200

Loading...

Locus: Os01g0261200

Loading...