Os01t0261200-02

Locus

Os01g0261200

Description

Similar to NAC domain-containing protein 74.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

NAC8

CGSNL Gene Name

NAC DOMAIN-CONTAINING PROTEIN 8

Oryzabase Gene Symbol Synonym(s)

OsNAC8, ONAC074, ONAC74, NAC74, OsNAC8/ONAC074, OsNTL3, NTL3

Oryzabase Gene Name Synonym(s)

OsNAC8 protein, NAC domain-containing protein 8, NAC domain-containing protein 074, NAC domain-containing protein 74, NAC membrane-bound transcription factor 3, NAC MTF3

Transcript Evidence

AK062259 (DDBJ, Best hit)

Protein Evidence

Q7GCL7 (UniProt)

Literature

Note

Manual Curation

Full-length cDNA

001-047-G11 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0261200-02)

RiceXPro (AK062259)

Others

Oryzabase (6235)

KEGG (Os01t0261200-02)

Transcript

1303 bp

>Os01t0261200-02 Similar to NAC domain-containing protein 74.
GGATGCATATGTACTTTGTCGTATTACCAAAAGAAATGACTGGATCCCAGGGAATGGCAA
TGAGTTGGACAACAGTGATCCTCATCCAGAACCATATGATGCTCCTCCATCAGTTATCAG
TACTGAACAGCTAAATCCTGCTGCTGAACCAGTTGTCGGTGTTGAAGCTGCACCAGTTAC
CGTTGCTGAACCTGACGGTGTTACTACGTCAGCTATCACTGCTAATATACCATCTCCTAG
TGATGACATTAATCTGGATGATTGGTTGAATGAACTATTTGATCCTTTCTTTGACCCTGA
ACAGAGTCTGGCTTCTGCTGATCTGTCTCCAGATGAACAAAATGTTGAATCATCGAACGT
AGGTGCTTTGGCTCCAAAGGTGGAACAAGACTATTCTAGTCCTAACGAGAACGTAGTAGA
TGATACGGAGTACTTGTTGCCTGAAGATGTTTACAACATACTGCACCCTGGTACAGATGA
CTTCAATATGCTCCAGAATCCTTTGGATCAGTACCCCATTCAATATGCAACCGATGTTTG
GAGTGGAATTCAGAAGGAAGAACTGTGGTCGCCCCAGGCCAATGCTGAGCCTAGTCAGTC
GAATGAAGCTGCTGATAATGGAATTATAAGACGTTATCGTAGTATGAAAACACCTGAAAC
TAGTGTGCCGCAGTTCAAGGGTAAAACTCAGGCTAAAATGCGGGTTGGGATCAACAAGAT
GGCTACGAGTAGTTCTGAATCTATCAACCAGACTATCAAGTTTGAGAACAGTGGTCGTCT
TGTTGAGCACCAGAAGAACCAAGCGCATGATGTAGCTTCTACCAAGCGGTCAGACGCAGG
GAAGCCAAGTACAGAGCTCAGCAGCAATCGAGGATTTCTCAGGGGTATCCGAAATGCATT
TGCAGGCTGTTCGGATGCTCGATGGAACATGATACTTGTTGCGGGTTTCGCTATTGGAGT
CGCTGTGGTAGCGCTTCATATAGGCCAACGCCTTGGATTAAGCCAGAGAGATCAGCAGCA
TACCTAGCCTTTAGGTTTGCAGGTTACTGGGTTTCTATGCTTTTTGCAATCTGGAGAAAC
GTAAACAAACTCCGATCTTTGGTTGGTGCAGAACATTTGATGTATGCGCCGTTTTTTTTG
TGTTGGTTTTGTACATATTATTATCTTCGGTTTTGGTCGACTTTTGTTCTCGCCAGCTAG
TAGTACTATGTTGACGAATGTAGAAGAAAACCTCAAAAAAAAAAGAACAAATGAAAAAAA
ATTGACGATGAAAATTTATATAATTAACCGCTTGCATTGTACT

CDS

1026 bp

>Os01t0261200-02 Similar to NAC domain-containing protein 74.
GATGCATATGTACTTTGTCGTATTACCAAAAGAAATGACTGGATCCCAGGGAATGGCAAT
GAGTTGGACAACAGTGATCCTCATCCAGAACCATATGATGCTCCTCCATCAGTTATCAGT
ACTGAACAGCTAAATCCTGCTGCTGAACCAGTTGTCGGTGTTGAAGCTGCACCAGTTACC
GTTGCTGAACCTGACGGTGTTACTACGTCAGCTATCACTGCTAATATACCATCTCCTAGT
GATGACATTAATCTGGATGATTGGTTGAATGAACTATTTGATCCTTTCTTTGACCCTGAA
CAGAGTCTGGCTTCTGCTGATCTGTCTCCAGATGAACAAAATGTTGAATCATCGAACGTA
GGTGCTTTGGCTCCAAAGGTGGAACAAGACTATTCTAGTCCTAACGAGAACGTAGTAGAT
GATACGGAGTACTTGTTGCCTGAAGATGTTTACAACATACTGCACCCTGGTACAGATGAC
TTCAATATGCTCCAGAATCCTTTGGATCAGTACCCCATTCAATATGCAACCGATGTTTGG
AGTGGAATTCAGAAGGAAGAACTGTGGTCGCCCCAGGCCAATGCTGAGCCTAGTCAGTCG
AATGAAGCTGCTGATAATGGAATTATAAGACGTTATCGTAGTATGAAAACACCTGAAACT
AGTGTGCCGCAGTTCAAGGGTAAAACTCAGGCTAAAATGCGGGTTGGGATCAACAAGATG
GCTACGAGTAGTTCTGAATCTATCAACCAGACTATCAAGTTTGAGAACAGTGGTCGTCTT
GTTGAGCACCAGAAGAACCAAGCGCATGATGTAGCTTCTACCAAGCGGTCAGACGCAGGG
AAGCCAAGTACAGAGCTCAGCAGCAATCGAGGATTTCTCAGGGGTATCCGAAATGCATTT
GCAGGCTGTTCGGATGCTCGATGGAACATGATACTTGTTGCGGGTTTCGCTATTGGAGTC
GCTGTGGTAGCGCTTCATATAGGCCAACGCCTTGGATTAAGCCAGAGAGATCAGCAGCAT
ACCTAG

Protein

342 aa

>Os01t0261200-02 Similar to NAC domain-containing protein 74.
DAYVLCRITKRNDWIPGNGNELDNSDPHPEPYDAPPSVISTEQLNPAAEPVVGVEAAPVT
VAEPDGVTTSAITANIPSPSDDINLDDWLNELFDPFFDPEQSLASADLSPDEQNVESSNV
GALAPKVEQDYSSPNENVVDDTEYLLPEDVYNILHPGTDDFNMLQNPLDQYPIQYATDVW
SGIQKEELWSPQANAEPSQSNEAADNGIIRRYRSMKTPETSVPQFKGKTQAKMRVGINKM
ATSSSESINQTIKFENSGRLVEHQKNQAHDVASTKRSDAGKPSTELSSNRGFLRGIRNAF
AGCSDARWNMILVAGFAIGVAVVALHIGQRLGLSQRDQQHT*

5'UTR

chr01:8794891..8794891 (- strand) : 1 bp

CDS

chr01:8794537..8794890 (- strand) : 354 bp

chr01:8792925..8793596 (- strand) : 672 bp

3'UTR

chr01:8792649..8792924 (- strand) : 276 bp

FASTA

>Os01t0261200-02 class=Sequence position=chr01:8792649..8794891 (- strand)
GGATGCATAT GTACTTTGTC GTATTACCAA AAGAAATGAC TGGATCCCAG GGAATGGCAA TGAGTTGGAC AACAGTGATC
CTCATCCAGA ACCATATGAT GCTCCTCCAT CAGTTATCAG TACTGAACAG CTAAATCCTG CTGCTGAACC AGTTGTCGGT
GTTGAAGCTG CACCAGTTAC CGTTGCTGAA CCTGACGGTG TTACTACGTC AGCTATCACT GCTAATATAC CATCTCCTAG
TGATGACATT AATCTGGATG ATTGGTTGAA TGAACTATTT GATCCTTTCT TTGACCCTGA ACAGAGTCTG GCTTCTGCTG
ATCTGTCTCC AGATGAACAA AATGTTGAAT CATCGGTGAG TTTCTTCACA GTCACTGTGT TTGCAGGTTA AATAATTCAA
TGGATAAATT ATTAGAATGT TGTAGTGACA TTATTAGAAT GTTGTAGTGA CTCCAGCTCC CTATGAGAAC GGGCTATTGC
ATGAACAAGA ATCTGTTGGA CAAATCTAAC ATGCTTGTTA CTCATAATAA ATTGATCTTC ACTGGTCCAC TTGTGCATAC
TGATTGCTAT TTAATATATC TGCATAATGC ATTTCTGATA GACAAAATAC TGAATAACTT CACGAACATA TAGAAACCAA
ACACAACATT GCATTATAGT AATGTTTGTG AGCCTAGTAC AGCACTGGTT ACTGCTTGGG AATTGATACT AAGCCTAGTA
CAGCACTGGT TACTGCTTGG GAATTGATAC TAATATGAAG CATGTGACTG GTAATGACCT TTAGAGATAC CTAGACATAG
GCAAATCACA ATGTTGTGAC CATTTTTTTT TGTGACTTAG TATGGCTGCC CTTTTATTTT CTTTTGCTGG TTGACAAAGA
AGATTTGCTT GTAATTTTTT TAGGAACACC GGAGTAATGC ATTCTCATGG ATAATATTTG AAACTCATTG AAAATTATTA
TGATTTGTTT GGATTGACTT TTTAAAAAAT AGCCATGATT TGCATATACC ATGGACTGAA GCTATCTTAT GTGTTACGGT
TTGTTCCACC TCTTCTGAGA TTTCTGGTTA TTGCCAAGTA TCTGGTCTGT TATATTATGG GGAAACGTTG ACTGTAGTTG
TGTTTTCATA CCATGTTCTT TCTTTAACAC GGAACCTAGG AGTCAATGTA TTTTCTGCAA ATCATGAATT GTACTTGTCA
TTGTGCTGTG CATTCTGCCA TTCTACTATG TTTTGATTGC AGTTCTTAGC CTGTGCATAC TTGCTCATCG CGCTATCTTC
CTTCTTAATT TACAGAACGT AGGTGCTTTG GCTCCAAAGG TGGAACAAGA CTATTCTAGT CCTAACGAGA ACGTAGTAGA
TGATACGGAG TACTTGTTGC CTGAAGATGT TTACAACATA CTGCACCCTG GTACAGATGA CTTCAATATG CTCCAGAATC
CTTTGGATCA GTACCCCATT CAATATGCAA CCGATGTTTG GAGTGGAATT CAGAAGGAAG AACTGTGGTC GCCCCAGGCC
AATGCTGAGC CTAGTCAGTC GAATGAAGCT GCTGATAATG GAATTATAAG ACGTTATCGT AGTATGAAAA CACCTGAAAC
TAGTGTGCCG CAGTTCAAGG GTAAAACTCA GGCTAAAATG CGGGTTGGGA TCAACAAGAT GGCTACGAGT AGTTCTGAAT
CTATCAACCA GACTATCAAG TTTGAGAACA GTGGTCGTCT TGTTGAGCAC CAGAAGAACC AAGCGCATGA TGTAGCTTCT
ACCAAGCGGT CAGACGCAGG GAAGCCAAGT ACAGAGCTCA GCAGCAATCG AGGATTTCTC AGGGGTATCC GAAATGCATT
TGCAGGCTGT TCGGATGCTC GATGGAACAT GATACTTGTT GCGGGTTTCG CTATTGGAGT CGCTGTGGTA GCGCTTCATA
TAGGCCAACG CCTTGGATTA AGCCAGAGAG ATCAGCAGCA TACCTAGCCT TTAGGTTTGC AGGTTACTGG GTTTCTATGC
TTTTTGCAAT CTGGAGAAAC GTAAACAAAC TCCGATCTTT GGTTGGTGCA GAACATTTGA TGTATGCGCC GTTTTTTTTG
TGTTGGTTTT GTACATATTA TTATCTTCGG TTTTGGTCGA CTTTTGTTCT CGCCAGCTAG TAGTACTATG TTGACGAATG
TAGAAGAAAA CCTCAAAAAA AAAAGAACAA ATGAAAAAAA ATTGACGATG AAAATTTATA TAATTAACCG CTTGCATTGT
ACT

Locus: Os01g0261200

Loading...

Locus: Os01g0261200

Loading...