Os01t0265800-01

Locus

Os01g0265800

Description

RNA binding protein, RNA metabolism, Regulation of genes important for plant growth and development

RAP-DB Gene Symbol Synonym(s)

RBP-P

RAP-DB Gene Name Synonym(s)

RNA binding protein P

CGSNL Gene Symbol

RBP-P

CGSNL Gene Name

RNA-BINDING PROTEIN P

Oryzabase Gene Symbol Synonym(s)

OsRBP-P

Oryzabase Gene Name Synonym(s)

RNA binding protein P

Transcript Evidence

AK099896

Protein Evidence

Q9LJ04

Literature

PMID: 30190374

PMID: 24682961

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

November 13, 2018

Gene Ontology (GO)

Molecular Function: nucleic acid binding (GO:0003676)

Functional domain (InterPro)

Nucleotide-binding alpha-beta plait domain superfamily (IPR012677)

RNA-binding domain superfamily (IPR035979)

RNA recognition motif domain (IPR000504)

Full-length cDNA

J013113M11 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0265800-01)

Others

Oryzabase (20911)

Transcript

1894 bp

>Os01t0265800-01 RNA binding protein, RNA metabolism, Regulation of genes important for plant growth and development
GCGAGCCCCAGACTCCACACCACACAGCCCCCCTTTCCCCTCCCCTCCACAGCCGTCGAA
ACCCTAGCCCCAAGGTTCCCCCACGCCTCGCGCTCGCCGTCGCCATGGGCAAGAAGCGGA
AGCTCGATTCCAAATCCCCCGCCGCCGCTAGGTCCGCAGCCGCCAGGGCCGCAGCAGCCG
CAGCCGCCGCCGCCGCCGCCGCCGCCGTCGCCGAGCCCTCCTCCCAGCCCGAAGCCCTAG
CCGAGGACCCGGCCCCCTCGTCGCAGCCCCTGGGCCTATCCAGCGAGGGCGCGGGGGAGA
GGATGATGTCCCGTGAGGCTGGCGGTGGCGAGGAAGAGGAGGTGGAGGAGGTCGAGGTGG
AGGAGGAGGTGGAGGTCGACGAGGACGAGGATGGGGAGGGGGAGGGGGAGGAGGAGGAGG
AGGCGGCGGAGAGGGACGCCGACTCGATCCAGGCGCTGCTGAATTCGTTCCCCAAGGACC
AGCTCGTTGAGCTGCTCAGCGCCGCGGCGCTCAGCCACGAGGACGTGCTCACGGCCGTCC
ACCGCGCGGCCGACGCCGACCCGGCGCTGCGGAAGATCTTCGTCCACGGCCTCGGCTGGG
ACGCCACCGCGGAGACCCTCACCGAGGCGTTCAGCGCCTACGGCGAGATCGAGGACCTCA
GGGTCGTCACCGACCGCGCCACGGGCAAGTGCAAGGGCTACGGTTTCATCCTCTTCAGCC
GCCGGTCCGGCGCCCGCGCGGCGCTCCGTGAGCCCCAGAAGAAGATTGGCAACCGCACCA
CGGCCTGCCAGCTCGCCTCTGTTGGTCCTGTGCCGCCGGGCGGCATGGCCACTAACCCTG
CCCCAGCGGTAGCCCCAGCCCCAGCGCAGCTGGCATTGCCGCCAGTGTCGGAGTACACGC
AGCGGAAAATTTTTGTCAGCAATGTCGGCGCAGACATAGACCCGCAGAAACTGCTGCAGT
TCTTTTCAAAGTATGGTGAGATTGAGGAGGGTCCTCTTGGGCTCGATAAGGTTACCGGGA
AGCCGAAGGGCTTTGCTCTATTTGTCTACAAGACCCTCGATAGTGCTAAGAAAGCGCTTC
AGGAGCCACACAAGCAATTCGAGGGGGTTGTGCTGCACTGCCAGAAGGCAATTGATGGAC
CAAAGCCCAACAAAGGTGGAGGACTTGGGGGTTTGTATGGTGCTGGCACTTCAGGCGGGA
GGAAAGGCGCTGGTGGTTATGGAGCTCATAGTCATTCTTTGCCTGGTGCTGCTGTTGGGG
GCCATGTGATGCCATCTCCAGTATCCAGTTTGACTTCATTGCCAGGTGTAGCTGGTGGCC
CAGGGGTGAATCCTGCTCTGGGGCAGGCCTTGACAGCTATCCTTGCCTCCCAGGGTGGAG
GGTTGGGTCTGAACAACATCCTGGGAGTTGGTGCAAATGGTTCAGGGTTGCCTAACCCAG
GGGCTTCTGCAGGACTGGGTAGTAGTGGTTTGCCTGGGATGCCTGGTGCTGGTGGTTATT
TGGGCGGCTATGGGGGTGGTGGTGGGTATGGCAGTACTCCACCAGGAGGCCCAGGAAGAA
ATTACATGGGTCATTAGGATGCTTATAACTATTTTACTGTGGCCAGATGATTCTACGTGT
TCCTGCTTCGCACTTATAAACTTGCTGTTTTAAGCTGTTTCTGGCAAATCGATTACTCTA
GTGGTCAAAGTTTTCACAAGAACTTTGTTTCCTCAATCCTATCTTTCAAAATTAAGCAGT
ATGTACAACTATTTAGATTTTCGAATGGCCATCAGGGCTTGTGACCTTATTGTAAAAGAG
CTTGTGTGGATTTAAAGAACCATGGATCTTTTCTACATCGTTTTGGCTAAATAAGTGCAG
ATTTTCAGCATAAGATCAGGTTACCTTTTAAATT

CDS

1473 bp

>Os01t0265800-01 RNA binding protein, RNA metabolism, Regulation of genes important for plant growth and development
ATGGGCAAGAAGCGGAAGCTCGATTCCAAATCCCCCGCCGCCGCTAGGTCCGCAGCCGCC
AGGGCCGCAGCAGCCGCAGCCGCCGCCGCCGCCGCCGCCGCCGTCGCCGAGCCCTCCTCC
CAGCCCGAAGCCCTAGCCGAGGACCCGGCCCCCTCGTCGCAGCCCCTGGGCCTATCCAGC
GAGGGCGCGGGGGAGAGGATGATGTCCCGTGAGGCTGGCGGTGGCGAGGAAGAGGAGGTG
GAGGAGGTCGAGGTGGAGGAGGAGGTGGAGGTCGACGAGGACGAGGATGGGGAGGGGGAG
GGGGAGGAGGAGGAGGAGGCGGCGGAGAGGGACGCCGACTCGATCCAGGCGCTGCTGAAT
TCGTTCCCCAAGGACCAGCTCGTTGAGCTGCTCAGCGCCGCGGCGCTCAGCCACGAGGAC
GTGCTCACGGCCGTCCACCGCGCGGCCGACGCCGACCCGGCGCTGCGGAAGATCTTCGTC
CACGGCCTCGGCTGGGACGCCACCGCGGAGACCCTCACCGAGGCGTTCAGCGCCTACGGC
GAGATCGAGGACCTCAGGGTCGTCACCGACCGCGCCACGGGCAAGTGCAAGGGCTACGGT
TTCATCCTCTTCAGCCGCCGGTCCGGCGCCCGCGCGGCGCTCCGTGAGCCCCAGAAGAAG
ATTGGCAACCGCACCACGGCCTGCCAGCTCGCCTCTGTTGGTCCTGTGCCGCCGGGCGGC
ATGGCCACTAACCCTGCCCCAGCGGTAGCCCCAGCCCCAGCGCAGCTGGCATTGCCGCCA
GTGTCGGAGTACACGCAGCGGAAAATTTTTGTCAGCAATGTCGGCGCAGACATAGACCCG
CAGAAACTGCTGCAGTTCTTTTCAAAGTATGGTGAGATTGAGGAGGGTCCTCTTGGGCTC
GATAAGGTTACCGGGAAGCCGAAGGGCTTTGCTCTATTTGTCTACAAGACCCTCGATAGT
GCTAAGAAAGCGCTTCAGGAGCCACACAAGCAATTCGAGGGGGTTGTGCTGCACTGCCAG
AAGGCAATTGATGGACCAAAGCCCAACAAAGGTGGAGGACTTGGGGGTTTGTATGGTGCT
GGCACTTCAGGCGGGAGGAAAGGCGCTGGTGGTTATGGAGCTCATAGTCATTCTTTGCCT
GGTGCTGCTGTTGGGGGCCATGTGATGCCATCTCCAGTATCCAGTTTGACTTCATTGCCA
GGTGTAGCTGGTGGCCCAGGGGTGAATCCTGCTCTGGGGCAGGCCTTGACAGCTATCCTT
GCCTCCCAGGGTGGAGGGTTGGGTCTGAACAACATCCTGGGAGTTGGTGCAAATGGTTCA
GGGTTGCCTAACCCAGGGGCTTCTGCAGGACTGGGTAGTAGTGGTTTGCCTGGGATGCCT
GGTGCTGGTGGTTATTTGGGCGGCTATGGGGGTGGTGGTGGGTATGGCAGTACTCCACCA
GGAGGCCCAGGAAGAAATTACATGGGTCATTAG

Protein

491 aa

>Os01t0265800-01 RNA binding protein, RNA metabolism, Regulation of genes important for plant growth and development
MGKKRKLDSKSPAAARSAAARAAAAAAAAAAAAAVAEPSSQPEALAEDPAPSSQPLGLSS
EGAGERMMSREAGGGEEEEVEEVEVEEEVEVDEDEDGEGEGEEEEEAAERDADSIQALLN
SFPKDQLVELLSAAALSHEDVLTAVHRAADADPALRKIFVHGLGWDATAETLTEAFSAYG
EIEDLRVVTDRATGKCKGYGFILFSRRSGARAALREPQKKIGNRTTACQLASVGPVPPGG
MATNPAPAVAPAPAQLALPPVSEYTQRKIFVSNVGADIDPQKLLQFFSKYGEIEEGPLGL
DKVTGKPKGFALFVYKTLDSAKKALQEPHKQFEGVVLHCQKAIDGPKPNKGGGLGGLYGA
GTSGGRKGAGGYGAHSHSLPGAAVGGHVMPSPVSSLTSLPGVAGGPGVNPALGQALTAIL
ASQGGGLGLNNILGVGANGSGLPNPGASAGLGSSGLPGMPGAGGYLGGYGGGGGYGSTPP
GGPGRNYMGH*

5'UTR

chr01:9066683..9066786 (- strand) : 104 bp

CDS

chr01:9065210..9066682 (- strand) : 1473 bp

3'UTR

chr01:9063968..9064284 (- strand) : 317 bp

FASTA

>Os01t0265800-01 class=Sequence position=chr01:9063968..9066786 (- strand)
GCGAGCCCCA GACTCCACAC CACACAGCCC CCCTTTCCCC TCCCCTCCAC AGCCGTCGAA ACCCTAGCCC CAAGGTTCCC
CCACGCCTCG CGCTCGCCGT CGCCATGGGC AAGAAGCGGA AGCTCGATTC CAAATCCCCC GCCGCCGCTA GGTCCGCAGC
CGCCAGGGCC GCAGCAGCCG CAGCCGCCGC CGCCGCCGCC GCCGCCGTCG CCGAGCCCTC CTCCCAGCCC GAAGCCCTAG
CCGAGGACCC GGCCCCCTCG TCGCAGCCCC TGGGCCTATC CAGCGAGGGC GCGGGGGAGA GGATGATGTC CCGTGAGGCT
GGCGGTGGCG AGGAAGAGGA GGTGGAGGAG GTCGAGGTGG AGGAGGAGGT GGAGGTCGAC GAGGACGAGG ATGGGGAGGG
GGAGGGGGAG GAGGAGGAGG AGGCGGCGGA GAGGGACGCC GACTCGATCC AGGCGCTGCT GAATTCGTTC CCCAAGGACC
AGCTCGTTGA GCTGCTCAGC GCCGCGGCGC TCAGCCACGA GGACGTGCTC ACGGCCGTCC ACCGCGCGGC CGACGCCGAC
CCGGCGCTGC GGAAGATCTT CGTCCACGGC CTCGGCTGGG ACGCCACCGC GGAGACCCTC ACCGAGGCGT TCAGCGCCTA
CGGCGAGATC GAGGACCTCA GGGTCGTCAC CGACCGCGCC ACGGGCAAGT GCAAGGGCTA CGGTTTCATC CTCTTCAGCC
GCCGGTCCGG CGCCCGCGCG GCGCTCCGTG AGCCCCAGAA GAAGATTGGC AACCGCACCA CGGCCTGCCA GCTCGCCTCT
GTTGGTCCTG TGCCGCCGGG CGGCATGGCC ACTAACCCTG CCCCAGCGGT AGCCCCAGCC CCAGCGCAGC TGGCATTGCC
GCCAGTGTCG GAGTACACGC AGCGGAAAAT TTTTGTCAGC AATGTCGGCG CAGACATAGA CCCGCAGAAA CTGCTGCAGT
TCTTTTCAAA GTATGGTGAG ATTGAGGAGG GTCCTCTTGG GCTCGATAAG GTTACCGGGA AGCCGAAGGG CTTTGCTCTA
TTTGTCTACA AGACCCTCGA TAGTGCTAAG AAAGCGCTTC AGGAGCCACA CAAGCAATTC GAGGGGGTTG TGCTGCACTG
CCAGAAGGCA ATTGATGGAC CAAAGCCCAA CAAAGGTGGA GGACTTGGGG GTTTGTATGG TGCTGGCACT TCAGGCGGGA
GGAAAGGCGC TGGTGGTTAT GGAGCTCATA GTCATTCTTT GCCTGGTGCT GCTGTTGGGG GCCATGTGAT GCCATCTCCA
GTATCCAGTT TGACTTCATT GCCAGGTGTA GCTGGTGGCC CAGGGGTGAA TCCTGCTCTG GGGCAGGCCT TGACAGCTAT
CCTTGCCTCC CAGGGTGGAG GGTTGGGTCT GAACAACATC CTGGGAGTTG GTGCAAATGG TTCAGGGTTG CCTAACCCAG
GGGCTTCTGC AGGACTGGGT AGTAGTGGTT TGCCTGGGAT GCCTGGTGCT GGTGGTTATT TGGGCGGCTA TGGGGGTGGT
GGTGGGTATG GCAGTACTCC ACCAGGAGGC CCAGGAAGAA ATTACATGGG TCATTAGGTA AGATCCGGAT AGGTGATTGT
GTCCCAACCA TAGGAACCTA CAAATAGTTT TCACATGTGT TTTCTGCCAA GAAATTGATC TTGCATTTTT TACATCGGTA
AAGAAATAGC TTTCCCTTTA TGAGTCGCTA TATTATTTAT CTCTTCTTGG TTGCTTTTAA ACTGAGTTTG CTTTTGCATG
AGCCAAggta ctctttttat ggtattgcta tttaggtaga tgcttcgcat gcacaatgaa agttaggata acatGCCATC
TTGTGTTAAT TTCTTTAATG CCACAATTGT TGCCATAAGA ATCTGAAGTC TGCATTTTGC AATCAAAATT TCAGGGAGTT
AATGCCTTAT GTTAGTGTTA GTTGAATCGT TTCCAATAAT TCTATTGCAC ATACTCTATA TTAGGCATAG CTTGGGAAAG
ATTTGGGAAG CTTGATATTC TATTAATCAA AAGAAATTGA AGTACAGCTA AATAATAATA GGAGATATGC GTAGGCTGGT
TGCTAGAGGT GAAATCACGT GCTTTTCTGG TCTCTTTTTT AGTTAAATGA TGCTTGATTT CTGGTTTATT TCTTTATCAT
GTCTGGCTCT CGGATTTACC AAAAGTATCC AAAGATATTT ACATGCACTA TCCATAGTCA TTCACAATTA TTCGCAATCA
TGCATGGTTC ATGTTGTGCC TTGTCATTCT CATGTGACTC AGTTTGCTCC TAACCTTATT TTGATGCGTA TGCAGTGCAA
CTGTTCAGCT AGGTTGTAAC ATATTAGTTA TTTCATAACC CTTCCATAAC GTTTTTTTAA CTGCTAGTAA ATCACCATAG
TACATGTATA TCATTTTTTC AGAAACTTAT TTTTTGTACA TACAAATTTT AACTTTTTGC AGACCCATTT CACTTATTTT
TATTCACCTT GCTATTTTAC AGGATGCTTA TAACTATTTT ACTGTGGCCA GATGATTCTA CGTGTTCCTG CTTCGCACTT
ATAAACTTGC TGTTTTAAGC TGTTTCTGGC AAATCGATTA CTCTAGTGGT CAAAGTTTTC ACAAGAACTT TGTTTCCTCA
ATCCTATCTT TCAAAATTAA GCAGTATGTA CAACTATTTA GATTTTCGAA TGGCCATCAG GGCTTGTGAC CTTATTGTAA
AAGAGCTTGT GTGGATTTAA AGAACCATGG ATCTTTTCTA CATCGTTTTG GCTAAATAAG TGCAGATTTT CAGCATAAGA
TCAGGTTACC TTTTAAATT

Locus: Os01g0265800

Loading...

Locus: Os01g0265800

Loading...