Os01t0265800-02

Locus

Os01g0265800

Description

RNA-binding region RNP-1 (RNA recognition motif) domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RBP-P

CGSNL Gene Name

RNA-BINDING PROTEIN P

Oryzabase Gene Symbol Synonym(s)

OsRBP-P

Oryzabase Gene Name Synonym(s)

RNA binding protein P

Transcript Evidence

AK109487 (DDBJ, Best hit)

Protein Evidence

NP_001149939.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: nucleotide binding (GO:0000166)

Molecular Function: nucleic acid binding (GO:0003676)

Functional domain (InterPro)

RNA recognition motif domain (IPR000504)

Nucleotide-binding, alpha-beta plait (IPR012677)

Full-length cDNA

001-203-A05 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0265800-02)

RiceXPro (AK109487)

Others

Oryzabase (20911)

KEGG (Os01t0265800-02)

Transcript

1786 bp

>Os01t0265800-02 RNA-binding region RNP-1  (RNA recognition motif) domain containing protein.
ACAGCCGTCGAAACCCTAGCCCCAAGGTTCCCCCACGCCTCGCGCTCGCCGTCGCCATGG
GCAAGAAGCGGAAGCTCGATTCCAAATCCCCCGCCGCCGCTAGGTCCGCAGCCGCCAGGG
CCGCAGCAGCCGCAGCCGCCGCCGCCGCCGCCGCCGCCGTCGCCGAGCCCTCCTCCCAGC
CCGAAGCCCTAGCCGAGGACCCGGCCCCCTCGTCGCAGCCCCTGGGCCTATCCAGCGAGG
GCGCGGGGGAGAGGATGATGTCCCGTGAGGCTGGCGGTGGCGAGGAAGAGGAGGTGGAGG
AGGTCGAGGTGGAGGAGGAGGTGGAGGTCGACGAGGACGAGGATGGGGAGGGGGAGGGGG
AGGAGGAGGAGGAGGCGGCGGAGAGGGACGCCGACTCGATCCAGGCGCTGCTGAATTCGT
TCCCCAAGGACCAGCTCGTTGAGCTGCTCAGCGCCGCGGCGCTCAGCCACGAGGACGTGC
TCACGGCCGTCCACCGCGCGGCCGACGCCGACCCGGCGCTGCGGAAGATCTTCGTCCACG
GCCTCGGCTGGGACGCCACCGCGGAGACCCTCACCGAGGCGTTCAGCGCCTACGGCGAGA
TCGAGGACCTCAGGGTCGTCACCGACCGCGCCACGGGCAAGTGCAAGGGCTACGGTTTCA
TCCTCTTCAGCCGCCGGTCCGGCGCCCGCGCGGCGCTCCGTGAGCCCCAGAAGAAGATTG
GCAACCGCACCACGGCCTGCCAGCTCGCCTCTGTTGGTCCTGTGCCGCCGGGCGGCATGG
CCACTAACCCTGCCCCAGCGGTAGCCCCAGCCCCAGCGCAGCTGGCATTGCCGCCAGTGT
CGGAGTACACGCAGCGGAAAATTTTTGTCAGCAATGTCGGCGCAGACATAGACCCGCAGA
AACTGCTGCAGTTCTTTTCAAAGTATGGTGAGATTGAGGAGGGTCCTCTTGGGCTCGATA
AGGTTACCGGGAAGCCGAAGGGCTTTGCTCTATTTGTCTACAAGACCCTCGATAGTGCTA
AGAAAGCGCTTCAGGAGCCACACAAGCAATTCGAGGGGGTTGTGCTGCACTGCCAGAAGG
CAATTGATGGACCAAAGCCCAACAAAGGTGGAGGACTTGGGGGTTTGTATGGTGCTGGCA
CTTCAGGCGGGAGGAAAGGCGCTGGTGGTTATGGAGCTCATAGTCATTCTTTGCCTGGTG
CTGCTGTTGGGGGCCATGTGATGCCATCTCCAGTATCCAGTTTGACTTCATTGCCAGGTG
TAGCTGGTGGCCCAGGGGTGAATCCTGCTCTGGGGCAGGCCTTGACAGCTATCCTTGCCT
CCCAGGGTGGAGGGTTGGGTCTGAACAACATCCTGGGAGTTGGTGCAAATGGTTCAGGGT
TGCCTAACCCAGGGGCTTCTGCAGGACTGGGTAGTAGTGGTTTGCCTGGGATGCCTGGTG
CTGGTGGTTATTTGGGCGGCTATGGGGGTGGTGGTGGGTATGGCAGTACTCCACCAGGAG
GCCCAGGAAGAAATTACATGGGTCATTAGGATGCTTATAACTATTTTACTGTGGCCAGAT
GATTCTACGTGTTCCTGCTTCGCACTTATAAACTTGCTGTTTTAAGCTGTTTCTGGCAAA
TCGATTACTCTAGTGGTCAAAGTTTTCACAAGAACTTTGTTTCCTCAATCCTATCTTTCA
AAATTAAGCAGTATGTACAACTATTTAGATTTTCGAATGGCCATCAGGGCTTGTGACCTT
ATTGTAAAAGAGCTTGTGTGGATTTAAAGAACCATGGATCTTTTCT

CDS

1473 bp

>Os01t0265800-02 RNA-binding region RNP-1  (RNA recognition motif) domain containing protein.
ATGGGCAAGAAGCGGAAGCTCGATTCCAAATCCCCCGCCGCCGCTAGGTCCGCAGCCGCC
AGGGCCGCAGCAGCCGCAGCCGCCGCCGCCGCCGCCGCCGCCGTCGCCGAGCCCTCCTCC
CAGCCCGAAGCCCTAGCCGAGGACCCGGCCCCCTCGTCGCAGCCCCTGGGCCTATCCAGC
GAGGGCGCGGGGGAGAGGATGATGTCCCGTGAGGCTGGCGGTGGCGAGGAAGAGGAGGTG
GAGGAGGTCGAGGTGGAGGAGGAGGTGGAGGTCGACGAGGACGAGGATGGGGAGGGGGAG
GGGGAGGAGGAGGAGGAGGCGGCGGAGAGGGACGCCGACTCGATCCAGGCGCTGCTGAAT
TCGTTCCCCAAGGACCAGCTCGTTGAGCTGCTCAGCGCCGCGGCGCTCAGCCACGAGGAC
GTGCTCACGGCCGTCCACCGCGCGGCCGACGCCGACCCGGCGCTGCGGAAGATCTTCGTC
CACGGCCTCGGCTGGGACGCCACCGCGGAGACCCTCACCGAGGCGTTCAGCGCCTACGGC
GAGATCGAGGACCTCAGGGTCGTCACCGACCGCGCCACGGGCAAGTGCAAGGGCTACGGT
TTCATCCTCTTCAGCCGCCGGTCCGGCGCCCGCGCGGCGCTCCGTGAGCCCCAGAAGAAG
ATTGGCAACCGCACCACGGCCTGCCAGCTCGCCTCTGTTGGTCCTGTGCCGCCGGGCGGC
ATGGCCACTAACCCTGCCCCAGCGGTAGCCCCAGCCCCAGCGCAGCTGGCATTGCCGCCA
GTGTCGGAGTACACGCAGCGGAAAATTTTTGTCAGCAATGTCGGCGCAGACATAGACCCG
CAGAAACTGCTGCAGTTCTTTTCAAAGTATGGTGAGATTGAGGAGGGTCCTCTTGGGCTC
GATAAGGTTACCGGGAAGCCGAAGGGCTTTGCTCTATTTGTCTACAAGACCCTCGATAGT
GCTAAGAAAGCGCTTCAGGAGCCACACAAGCAATTCGAGGGGGTTGTGCTGCACTGCCAG
AAGGCAATTGATGGACCAAAGCCCAACAAAGGTGGAGGACTTGGGGGTTTGTATGGTGCT
GGCACTTCAGGCGGGAGGAAAGGCGCTGGTGGTTATGGAGCTCATAGTCATTCTTTGCCT
GGTGCTGCTGTTGGGGGCCATGTGATGCCATCTCCAGTATCCAGTTTGACTTCATTGCCA
GGTGTAGCTGGTGGCCCAGGGGTGAATCCTGCTCTGGGGCAGGCCTTGACAGCTATCCTT
GCCTCCCAGGGTGGAGGGTTGGGTCTGAACAACATCCTGGGAGTTGGTGCAAATGGTTCA
GGGTTGCCTAACCCAGGGGCTTCTGCAGGACTGGGTAGTAGTGGTTTGCCTGGGATGCCT
GGTGCTGGTGGTTATTTGGGCGGCTATGGGGGTGGTGGTGGGTATGGCAGTACTCCACCA
GGAGGCCCAGGAAGAAATTACATGGGTCATTAG

Protein

491 aa

>Os01t0265800-02 RNA-binding region RNP-1  (RNA recognition motif) domain containing protein.
MGKKRKLDSKSPAAARSAAARAAAAAAAAAAAAAVAEPSSQPEALAEDPAPSSQPLGLSS
EGAGERMMSREAGGGEEEEVEEVEVEEEVEVDEDEDGEGEGEEEEEAAERDADSIQALLN
SFPKDQLVELLSAAALSHEDVLTAVHRAADADPALRKIFVHGLGWDATAETLTEAFSAYG
EIEDLRVVTDRATGKCKGYGFILFSRRSGARAALREPQKKIGNRTTACQLASVGPVPPGG
MATNPAPAVAPAPAQLALPPVSEYTQRKIFVSNVGADIDPQKLLQFFSKYGEIEEGPLGL
DKVTGKPKGFALFVYKTLDSAKKALQEPHKQFEGVVLHCQKAIDGPKPNKGGGLGGLYGA
GTSGGRKGAGGYGAHSHSLPGAAVGGHVMPSPVSSLTSLPGVAGGPGVNPALGQALTAIL
ASQGGGLGLNNILGVGANGSGLPNPGASAGLGSSGLPGMPGAGGYLGGYGGGGGYGSTPP
GGPGRNYMGH*

5'UTR

chr01:9066683..9066738 (- strand) : 56 bp

CDS

chr01:9065210..9066682 (- strand) : 1473 bp

3'UTR

chr01:9064028..9064284 (- strand) : 257 bp

FASTA

>Os01t0265800-02 class=Sequence position=chr01:9064028..9066738 (- strand)
ACAGCCGTCG AAACCCTAGC CCCAAGGTTC CCCCACGCCT CGCGCTCGCC GTCGCCATGG GCAAGAAGCG GAAGCTCGAT
TCCAAATCCC CCGCCGCCGC TAGGTCCGCA GCCGCCAGGG CCGCAGCAGC CGCAGCCGCC GCCGCCGCCG CCGCCGCCGT
CGCCGAGCCC TCCTCCCAGC CCGAAGCCCT AGCCGAGGAC CCGGCCCCCT CGTCGCAGCC CCTGGGCCTA TCCAGCGAGG
GCGCGGGGGA GAGGATGATG TCCCGTGAGG CTGGCGGTGG CGAGGAAGAG GAGGTGGAGG AGGTCGAGGT GGAGGAGGAG
GTGGAGGTCG ACGAGGACGA GGATGGGGAG GGGGAGGGGG AGGAGGAGGA GGAGGCGGCG GAGAGGGACG CCGACTCGAT
CCAGGCGCTG CTGAATTCGT TCCCCAAGGA CCAGCTCGTT GAGCTGCTCA GCGCCGCGGC GCTCAGCCAC GAGGACGTGC
TCACGGCCGT CCACCGCGCG GCCGACGCCG ACCCGGCGCT GCGGAAGATC TTCGTCCACG GCCTCGGCTG GGACGCCACC
GCGGAGACCC TCACCGAGGC GTTCAGCGCC TACGGCGAGA TCGAGGACCT CAGGGTCGTC ACCGACCGCG CCACGGGCAA
GTGCAAGGGC TACGGTTTCA TCCTCTTCAG CCGCCGGTCC GGCGCCCGCG CGGCGCTCCG TGAGCCCCAG AAGAAGATTG
GCAACCGCAC CACGGCCTGC CAGCTCGCCT CTGTTGGTCC TGTGCCGCCG GGCGGCATGG CCACTAACCC TGCCCCAGCG
GTAGCCCCAG CCCCAGCGCA GCTGGCATTG CCGCCAGTGT CGGAGTACAC GCAGCGGAAA ATTTTTGTCA GCAATGTCGG
CGCAGACATA GACCCGCAGA AACTGCTGCA GTTCTTTTCA AAGTATGGTG AGATTGAGGA GGGTCCTCTT GGGCTCGATA
AGGTTACCGG GAAGCCGAAG GGCTTTGCTC TATTTGTCTA CAAGACCCTC GATAGTGCTA AGAAAGCGCT TCAGGAGCCA
CACAAGCAAT TCGAGGGGGT TGTGCTGCAC TGCCAGAAGG CAATTGATGG ACCAAAGCCC AACAAAGGTG GAGGACTTGG
GGGTTTGTAT GGTGCTGGCA CTTCAGGCGG GAGGAAAGGC GCTGGTGGTT ATGGAGCTCA TAGTCATTCT TTGCCTGGTG
CTGCTGTTGG GGGCCATGTG ATGCCATCTC CAGTATCCAG TTTGACTTCA TTGCCAGGTG TAGCTGGTGG CCCAGGGGTG
AATCCTGCTC TGGGGCAGGC CTTGACAGCT ATCCTTGCCT CCCAGGGTGG AGGGTTGGGT CTGAACAACA TCCTGGGAGT
TGGTGCAAAT GGTTCAGGGT TGCCTAACCC AGGGGCTTCT GCAGGACTGG GTAGTAGTGG TTTGCCTGGG ATGCCTGGTG
CTGGTGGTTA TTTGGGCGGC TATGGGGGTG GTGGTGGGTA TGGCAGTACT CCACCAGGAG GCCCAGGAAG AAATTACATG
GGTCATTAGG TAAGATCCGG ATAGGTGATT GTGTCCCAAC CATAGGAACC TACAAATAGT TTTCACATGT GTTTTCTGCC
AAGAAATTGA TCTTGCATTT TTTACATCGG TAAAGAAATA GCTTTCCCTT TATGAGTCGC TATATTATTT ATCTCTTCTT
GGTTGCTTTT AAACTGAGTT TGCTTTTGCA TGAGCCAAgg tactcttttt atggtattgc tatttaggta gatgcttcgc
atgcacaatg aaagttagga taacatGCCA TCTTGTGTTA ATTTCTTTAA TGCCACAATT GTTGCCATAA GAATCTGAAG
TCTGCATTTT GCAATCAAAA TTTCAGGGAG TTAATGCCTT ATGTTAGTGT TAGTTGAATC GTTTCCAATA ATTCTATTGC
ACATACTCTA TATTAGGCAT AGCTTGGGAA AGATTTGGGA AGCTTGATAT TCTATTAATC AAAAGAAATT GAAGTACAGC
TAAATAATAA TAGGAGATAT GCGTAGGCTG GTTGCTAGAG GTGAAATCAC GTGCTTTTCT GGTCTCTTTT TTAGTTAAAT
GATGCTTGAT TTCTGGTTTA TTTCTTTATC ATGTCTGGCT CTCGGATTTA CCAAAAGTAT CCAAAGATAT TTACATGCAC
TATCCATAGT CATTCACAAT TATTCGCAAT CATGCATGGT TCATGTTGTG CCTTGTCATT CTCATGTGAC TCAGTTTGCT
CCTAACCTTA TTTTGATGCG TATGCAGTGC AACTGTTCAG CTAGGTTGTA ACATATTAGT TATTTCATAA CCCTTCCATA
ACGTTTTTTT AACTGCTAGT AAATCACCAT AGTACATGTA TATCATTTTT TCAGAAACTT ATTTTTTGTA CATACAAATT
TTAACTTTTT GCAGACCCAT TTCACTTATT TTTATTCACC TTGCTATTTT ACAGGATGCT TATAACTATT TTACTGTGGC
CAGATGATTC TACGTGTTCC TGCTTCGCAC TTATAAACTT GCTGTTTTAA GCTGTTTCTG GCAAATCGAT TACTCTAGTG
GTCAAAGTTT TCACAAGAAC TTTGTTTCCT CAATCCTATC TTTCAAAATT AAGCAGTATG TACAACTATT TAGATTTTCG
AATGGCCATC AGGGCTTGTG ACCTTATTGT AAAAGAGCTT GTGTGGATTT AAAGAACCAT GGATCTTTTC T

Locus: Os01g0265800

Loading...

Locus: Os01g0265800

Loading...