Os01t0267200-01

Locus

Os01g0267200

Description

Similar to 26S proteasome non-ATPase regulatory subunit 14 (26S proteasome regulatory subunit rpn11).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RPN11

CGSNL Gene Name

19S REGULATORY PARTICLE NON-ATPASE SUBUNIT 11

Oryzabase Gene Symbol Synonym(s)

OsRpn11, Rpn11

Oryzabase Gene Name Synonym(s)

19S regulatory particle non-ATPase subunit 11, RP non-ATPase 11

Transcript Evidence

AK099455 (DDBJ, Best hit)

Protein Evidence

B4FLQ8 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

Mov34/MPN/PAD-1 (IPR000555)

Full-length cDNA

J013022M19 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0267200-01)

RiceXPro (AK099455)

Others

Oryzabase (20570)

KEGG (Os01t0267200-01)

Transcript

1218 bp

>Os01t0267200-01 Similar to 26S proteasome non-ATPase regulatory subunit 14 (26S proteasome regulatory subunit rpn11).
GCAGTCGCAGCCTCTTTCCTCCTCCGTCTCTCTCTCCCCTCTTCCTCTCCTCCGCGCGGC
GAACGAAGCGAGCGAGCGGCGGCCATGGAGCGGCTGCAGCGGATCTTCGGGGCGTCGGGG
ATGGGGCAGCCGCCGACGGACTCGCCGCTGCTCGACTCCTCCGAGCAGGTCTACATCTCC
TCCCTCGCCCTCCTCAAGATGCTCAAGCACGGGCGGGCCGGCGTGCCGATGGAGGTGATG
GGGCTGATGCTCGGGGAGTTCGTCGACGACTACACCGTCAGGGTGGTCGACGTCTTCGCC
ATGCCGCAGAGCGGGACGGGCGTCAGCGTCGAGGCCGTCGACCACGTCTTCCAGACCAAC
ATGCTCGACATGCTCAAGCAGACCGGGAGACCAGAAATGGTGGTGGGCTGGTATCACTCC
CATCCTGGATTTGGATGTTGGCTTTCAGGTGTTGATATCAACACTCAGCAGAGTTTTGAA
GCTTTAAATCCCAGGGCTGTTGCAGTTGTGATAGACCCAATCCAGAGTGTCAAGGGGAAG
GTGGTCATTGATGCATTTCGTCTCATTAATCCTCAGACCATGATGCTTGGCCAGGAACCG
CGACAGACAACATCAAATGTTGGGCATCTAAACAAACCATCTATCCAGGCTCTTATTCAC
GGGCTGAACAGACACTACTACTCCATTGCAATCAATTACCGCAAAAATGAACTGGAGGAG
AAAATGTTGCTTAACTTACACAAAAAGAAATGGACCGATGGATTGATTTTGAAGAGTTTT
GACACTCATTCGAAAACCAATGAGCAGACTGTTCAGGAAATGCTGAACCTAGCCATCAAA
TATAACAAGGCAGTGCAGGAGGAGGATGAGCTGCCACCTGAGAAACTAGCGATTGCCAAT
GTGGGACGGCAGGATGCCAAGAAGCACTTGGAAGAGCATGTCTCAAATTTGATGTCGTCA
AACATAGTTCAGACCCTAGGAACCATGCTCGACACGGTTGTGTTCTAGTCTCCTTCTACT
GTTGTGTCAACCCTATACAGACCCCCACCCAAATTATTATTTATGTTTATCGAAGCCTCT
GCCGTAATTCTGTAACTTTTGGTGCCAGCTACATTTGGGTTCTAACAGTTCGACTTGAAG
AATTTGTTTTCTTTTAGCACGGTGTACTGTTAATCTTCTGTTGATTTCGCTGCATTTTCA
AGGTTCCATCACTTGATG

CDS

924 bp

>Os01t0267200-01 Similar to 26S proteasome non-ATPase regulatory subunit 14 (26S proteasome regulatory subunit rpn11).
ATGGAGCGGCTGCAGCGGATCTTCGGGGCGTCGGGGATGGGGCAGCCGCCGACGGACTCG
CCGCTGCTCGACTCCTCCGAGCAGGTCTACATCTCCTCCCTCGCCCTCCTCAAGATGCTC
AAGCACGGGCGGGCCGGCGTGCCGATGGAGGTGATGGGGCTGATGCTCGGGGAGTTCGTC
GACGACTACACCGTCAGGGTGGTCGACGTCTTCGCCATGCCGCAGAGCGGGACGGGCGTC
AGCGTCGAGGCCGTCGACCACGTCTTCCAGACCAACATGCTCGACATGCTCAAGCAGACC
GGGAGACCAGAAATGGTGGTGGGCTGGTATCACTCCCATCCTGGATTTGGATGTTGGCTT
TCAGGTGTTGATATCAACACTCAGCAGAGTTTTGAAGCTTTAAATCCCAGGGCTGTTGCA
GTTGTGATAGACCCAATCCAGAGTGTCAAGGGGAAGGTGGTCATTGATGCATTTCGTCTC
ATTAATCCTCAGACCATGATGCTTGGCCAGGAACCGCGACAGACAACATCAAATGTTGGG
CATCTAAACAAACCATCTATCCAGGCTCTTATTCACGGGCTGAACAGACACTACTACTCC
ATTGCAATCAATTACCGCAAAAATGAACTGGAGGAGAAAATGTTGCTTAACTTACACAAA
AAGAAATGGACCGATGGATTGATTTTGAAGAGTTTTGACACTCATTCGAAAACCAATGAG
CAGACTGTTCAGGAAATGCTGAACCTAGCCATCAAATATAACAAGGCAGTGCAGGAGGAG
GATGAGCTGCCACCTGAGAAACTAGCGATTGCCAATGTGGGACGGCAGGATGCCAAGAAG
CACTTGGAAGAGCATGTCTCAAATTTGATGTCGTCAAACATAGTTCAGACCCTAGGAACC
ATGCTCGACACGGTTGTGTTCTAG

Protein

308 aa

>Os01t0267200-01 Similar to 26S proteasome non-ATPase regulatory subunit 14 (26S proteasome regulatory subunit rpn11).
MERLQRIFGASGMGQPPTDSPLLDSSEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFV
DDYTVRVVDVFAMPQSGTGVSVEAVDHVFQTNMLDMLKQTGRPEMVVGWYHSHPGFGCWL
SGVDINTQQSFEALNPRAVAVVIDPIQSVKGKVVIDAFRLINPQTMMLGQEPRQTTSNVG
HLNKPSIQALIHGLNRHYYSIAINYRKNELEEKMLLNLHKKKWTDGLILKSFDTHSKTNE
QTVQEMLNLAIKYNKAVQEEDELPPEKLAIANVGRQDAKKHLEEHVSNLMSSNIVQTLGT
MLDTVVF*

5'UTR

chr01:9166370..9166453 (+ strand) : 84 bp

CDS

chr01:9166454..9166580 (+ strand) : 127 bp

chr01:9166658..9166835 (+ strand) : 178 bp

chr01:9168256..9168337 (+ strand) : 82 bp

chr01:9168907..9169083 (+ strand) : 177 bp

chr01:9169174..9169341 (+ strand) : 168 bp

chr01:9169466..9169657 (+ strand) : 192 bp

3'UTR

chr01:9169658..9169867 (+ strand) : 210 bp

FASTA

>Os01t0267200-01 class=Sequence position=chr01:9166370..9169867 (+ strand)
GCAGTCGCAG CCTCTTTCCT CCTCCGTCTC TCTCTCCCCT CTTCCTCTCC TCCGCGCGGC GAACGAAGCG AGCGAGCGGC
GGCCATGGAG CGGCTGCAGC GGATCTTCGG GGCGTCGGGG ATGGGGCAGC CGCCGACGGA CTCGCCGCTG CTCGACTCCT
CCGAGCAGGT CTACATCTCC TCCCTCGCCC TCCTCAAGAT GCTCAAGCAC GGTCAGTCCC CCTCTCCTCC TCCTCAATGA
TGGGGGATAT TAAGGTTTCC GTTGATTTTG GTTTTGCGGC GCGCGCAGGG CGGGCCGGCG TGCCGATGGA GGTGATGGGG
CTGATGCTCG GGGAGTTCGT CGACGACTAC ACCGTCAGGG TGGTCGACGT CTTCGCCATG CCGCAGAGCG GGACGGGCGT
CAGCGTCGAG GCCGTCGACC ACGTCTTCCA GACCAACATG CTCGACATGC TCAAGCAGAC CGGGAGGTAA TCCCCTCTTG
CCCCCGCCGC CGATCTAGAG AAAAAAACGG CGGATCTGTT GGTTCCCTTT CTATCTCTCT CCCTTGTTCA GATTTGGTGC
GCTTTGCTTG ATTAATCTGC GCAGGATTTG CCCCCCCCCC CCCCCGCCCC CTCTTTCAGG GCACCTTAGA TGAGCTGATC
TTGATACATA ACAACTACTA CTATTTTCTC CTTCAGATTG GTGTAGATGG TTTTGTGTAT ACATGCGTTA ATTTTGTAAA
CGGTCCTTTT ATTTTTTAGA TAATGGGAAT GGATTACATC TCCGGCCTTT TCAGCAGGCA CAACCAGAAT TGGCTCCATT
ACAACACTTG GCTCAACTGA CTTTGGAAAT ATCTACTGTT CATAGTCATA GAGCAGTTTG GGGCAACTCA TTTAGGCATC
ACAGCTGAAA AACCCTCTAG GCAGTAGAGT AACATTAGTC TGTGTGAGCA CATTTTTCTT TTATTGTGTA CTTGTTTCAT
GATAACAACC AAATTGCCGT TTTCTGCATT TTTTTGTGGG CTTTGTGCTG TCATCACAAG TCAGTTTGCA GACTGCATGC
TTGAATTTGG AAGCCAAAGT ATAAGTCAAT GTTGGTAAAA GCTCTAGAAT CAGTTGTGTT TCTTGCTCTT TGATGCATCC
AAACATTCAT GTGAAGAGAA TAAGGTCCCA ATGCAATTCT TCTGAAGGAT TACAGTATTT TTACTTCCTT GAGATGTTCT
AAGCAAATCC TTTGGATAGT TGACAAGGTC CCCCCAAAGA AAAAAATGAA TGCTTTGTGT AAAGTTTGAT AATATATAGT
GATTGAGTTG ATGTTGGAGA TAGATCTTTG TATCTATTTG AACACATACC ACTAACTTGC TGTTCAGTAA CAGCTAGGCC
TACCAGTTGT ATTATATAAT GCATTGGTAG CAATGTCATC CTTATCGTTG TTGAATTGGT ACATTGGTTC ACATCCTTAT
CATTGTTAAC ACCACATCGA TGTCTGTGCA TCATAGTTCT ACGGCTGATA TTTTGTATGG AGTACCTAGC AAACAAGTAA
GTTGGGGACA GAAGTACCTA GCAGCTGTGA ACACCTTATA TACATCTTAT GTTCTAATGC GTGTTGTAAA TAGGATTTTG
GTTACTGGGC CTACTTGTTT GTTATGCTAG GGGAATATTT TAGAAATTGC TTAAGAAGGA AGACGCTTTC TAAATGAACT
TCTTCTCAGT TTTGTCGATG CATTTCTAGG ATATGTTACT CCCAAGTGCT AGAAAATTGT TTGTACAGTA ATACTGGCCA
TGGTCTTATA TCTGTTTCTT TTATCAACAC TCTCAGTCTG ATGATCTAGA ATTATTTACT TTTATTTACA CCGTTGTTTT
TAGGCTGTTT AACGTGATTT TGTGGCCACT TGTGTTATCT TTACAGACCA GAAATGGTGG TGGGCTGGTA TCACTCCCAT
CCTGGATTTG GATGTTGGCT TTCAGGTGTT GATATCAACA CTCAGCAGGT GCATATGCTT ATTCTACCTT TTTATAAGTT
TTGTTAAAAG GAGCAATTGT TTCACATTTG ACAAATGGAA ACAATTGATG TGTCCAAACA TGTGGCACTG CATGCAGCAT
GTCAGTTAAT CAAATATCTA GAAATAATTT GATCAATTGA AATGGGTAAA GAGAGTAAAA GGTGGCATAC ATTTGGTATC
TTTTATGTTA TCTTATGTTT CTTCTGCTTA TCCCATTGTC ATCAAGTAGT TATATGCTTA TATCGGTGGT AGTTGGTCTG
CAAGGATGGT CCATACTCTT GAAATTGACT GACCATGTTT CATATCTACC TCGAGCTTCT GTTCACTAAT CACTAGCTTG
TTGGAGCTGA TGCATATTTG GTGAACAGTA TGAATCTTAT GTCTAATCTG GGGCAGGGAT CATAAAATAT ACAAATTTAA
GAATACTAGG TGGTGATTTG TAAATTCTTC CAAGGGTTAA AGCTTAATTT GTTGCAAAAT ATGTTGACAC TTATTTTTCT
ATGTAAACAT GCGTATTGAA AGTGAGTATG TCTAACAGCT TAAATGGAAT TGTGCAGAGT TTTGAAGCTT TAAATCCCAG
GGCTGTTGCA GTTGTGATAG ACCCAATCCA GAGTGTCAAG GGGAAGGTGG TCATTGATGC ATTTCGTCTC ATTAATCCTC
AGACCATGAT GCTTGGCCAG GAACCGCGAC AGACAACATC AAATGTTGGG CATCTAAACA AACCATCTAT CCAGGTAAAG
TTCTCACTAT TAATAATACT GCTACCAATG AACTTTTGCT CTATCAATTA TCTATATTTG ATTCAAACTT ATTTGTGTTG
TAAGGCTCTT ATTCACGGGC TGAACAGACA CTACTACTCC ATTGCAATCA ATTACCGCAA AAATGAACTG GAGGAGAAAA
TGTTGCTTAA CTTACACAAA AAGAAATGGA CCGATGGATT GATTTTGAAG AGTTTTGACA CTCATTCGAA AACCAATGAG
CAGACTGTTC AGGTGCGTGG CATTCTACTT TCAACCGTAC CATAGATGAT CCTTCAGAAC AACCCTTTAA TTCATGTTGC
AAAGTTTCGT ACTAGTTAGC TACTACTAGT ACTTATATGT GTGTTTTCAC GTGCAGGAAA TGCTGAACCT AGCCATCAAA
TATAACAAGG CAGTGCAGGA GGAGGATGAG CTGCCACCTG AGAAACTAGC GATTGCCAAT GTGGGACGGC AGGATGCCAA
GAAGCACTTG GAAGAGCATG TCTCAAATTT GATGTCGTCA AACATAGTTC AGACCCTAGG AACCATGCTC GACACGGTTG
TGTTCTAGTC TCCTTCTACT GTTGTGTCAA CCCTATACAG ACCCCCACCC AAATTATTAT TTATGTTTAT CGAAGCCTCT
GCCGTAATTC TGTAACTTTT GGTGCCAGCT ACATTTGGGT TCTAACAGTT CGACTTGAAG AATTTGTTTT CTTTTAGCAC
GGTGTACTGT TAATCTTCTG TTGATTTCGC TGCATTTTCA AGGTTCCATC ACTTGATG