Os01t0268100-01

Locus

Os01g0268100

Description

Similar to Major facilitator superfamily antiporter.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ZIFL1

CGSNL Gene Name

ZINC-INDUCED FACILITATOR-LIKE 1

Oryzabase Gene Symbol Synonym(s)

OsZIFL1

Oryzabase Gene Name Synonym(s)

zinc-induced facilitator-like 1

Transcript Evidence

AK066443 (DDBJ, Best hit)

Protein Evidence

NP_001150835.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: transmembrane transport (GO:0055085)

Cellular Component: integral to membrane (GO:0016021)

Functional domain (InterPro)

Major facilitator superfamily (IPR011701)

Major facilitator superfamily domain, general substrate transporter (IPR016196)

Major facilitator superfamily domain (IPR020846)

Full-length cDNA

J013067J16 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0268100-01)

RiceXPro (AK066443)

Others

Oryzabase (9470)

KEGG (Os01t0268100-01)

Transcript

1613 bp

>Os01t0268100-01 Similar to Major facilitator superfamily antiporter.
GATCCAGGGGGGGGGGGTGGTGAAGAGCTAGAGCTGGCGGCGGGTTGTTGAGGAGCGGCT
GACTGAGGGGAGACCAGACCAATGGTTGGCGGCGGGGCGGGCGAGCCGCTGAGGAGGGCG
TGGGGGTACCACCCCGAGTGCCCCGGATGCAGGGTGGACAGGAGGAAGGAGGAGAGGGAG
GGGATCCCCTACACGGAGCTCTCCCTCATCTGGCTCGTCACCGTCTCCTCCACCCTGCCG
ATACAATCCCTGTTTCCCTTCTTGTATTTTATGATAAGGGACCTGCATATTGCTAAACAA
GAAGAAGATATTGGATTTTATGCTGGTTTTGTCGGCGCTTCATATATGTTTGGAAGAGCA
CTCTCCTCTGTGATATGGGGCATCGTGGCTGATAAGTACGGGAGGAAGCCGATTATTATA
ATTACCCTTATTTCAATAATTATTTTCAATACACTCTTTGGACTCAGCTCAAGTTATTGG
ATGGCATTAACCTCAAGAGGTTTGCTTGGTCTGATGTGTGGTATACTTGGCCCAATTAAG
GCCTATGCTACAGAAGTGTGCCGAAAAGAACACGGTCACCTTGGACTATCCCTTGTTTCT
TCCTCACGTGGCATAGGCCTTATTGTGGGACCAGCTATTGGTGGTTATCTTGCACAGCCT
GCAGATAAATATCCAAGCATATTCTCTGAGAAGTCTATATTTGGGAGGTTTCCGTATTTT
CTCCCCTGCTTATGTATATCCCTCCTTGCCATTGTTGCTCTACTTGCTTCCTTCTGGCTC
CCGGAAACTTTGCATAAGCACACTCAGGATATGGTTTTAGAGGATTCAATTTCTGTAGAA
GAAGGTCTTTCTGGTCCAACTGCTGAAGAAAATAGTGCTGGATGTCTAAATTTATTCACA
AACTGGCCACTGATGTCTGCTATCATTGCATACTGCATATTCTCTCTTCAGGATGTGGCT
TATGCTGAGgtattttctctatgggctgtcagcgacaggaagtatggtggattaagcttt
tcttcccaagatgtgggtagtgtccttgcattctcagGTCTCTTCCTCCTGGTATTCCAA
ATTTTGGTTTACCCGTCAGTGGCAAAATCAGTAGAGCCCATCACGCTTGTCCGTATAGTG
GCAATATTGACTATACCACTTCTTTCTAGCTATCCATTTATGGCCGGATTGTCAGGGTCC
ATTCTTCAATTGATAGTTAACTGTGCATCTTTTCTGAAGAATGCTTTTGCAGTTACTACC
ATCACTGTATTCAACATCTTAATGAATGATGCTGTGGCTCAGGACGTTAGAGCTTCAGCC
AACGGTGTTGCTGTAACTCTGATGTCCATCTTTAAAGCTATTGCTCCAGCAATTGCAGGA
GCTATATTTGCATGGGCTCAAAGGCGTCAGACAGCTTCATTTCTCCCAGGCGACCACCTG
GTATTCTTCATGCTGAACGTCTTCACAGTCATCGGTCTTGTGAGCACTTTCAGGCCGTTT
TACGCTAGAAGAAGCACGAAGCACGATCCCATTACTACTTAGCACTAACCATTCTACTCA
GGACCTGAGGTCTGAtgtagacccccatttttataacaggaatcactcgtgtt

CDS

1461 bp

>Os01t0268100-01 Similar to Major facilitator superfamily antiporter.
ATGGTTGGCGGCGGGGCGGGCGAGCCGCTGAGGAGGGCGTGGGGGTACCACCCCGAGTGC
CCCGGATGCAGGGTGGACAGGAGGAAGGAGGAGAGGGAGGGGATCCCCTACACGGAGCTC
TCCCTCATCTGGCTCGTCACCGTCTCCTCCACCCTGCCGATACAATCCCTGTTTCCCTTC
TTGTATTTTATGATAAGGGACCTGCATATTGCTAAACAAGAAGAAGATATTGGATTTTAT
GCTGGTTTTGTCGGCGCTTCATATATGTTTGGAAGAGCACTCTCCTCTGTGATATGGGGC
ATCGTGGCTGATAAGTACGGGAGGAAGCCGATTATTATAATTACCCTTATTTCAATAATT
ATTTTCAATACACTCTTTGGACTCAGCTCAAGTTATTGGATGGCATTAACCTCAAGAGGT
TTGCTTGGTCTGATGTGTGGTATACTTGGCCCAATTAAGGCCTATGCTACAGAAGTGTGC
CGAAAAGAACACGGTCACCTTGGACTATCCCTTGTTTCTTCCTCACGTGGCATAGGCCTT
ATTGTGGGACCAGCTATTGGTGGTTATCTTGCACAGCCTGCAGATAAATATCCAAGCATA
TTCTCTGAGAAGTCTATATTTGGGAGGTTTCCGTATTTTCTCCCCTGCTTATGTATATCC
CTCCTTGCCATTGTTGCTCTACTTGCTTCCTTCTGGCTCCCGGAAACTTTGCATAAGCAC
ACTCAGGATATGGTTTTAGAGGATTCAATTTCTGTAGAAGAAGGTCTTTCTGGTCCAACT
GCTGAAGAAAATAGTGCTGGATGTCTAAATTTATTCACAAACTGGCCACTGATGTCTGCT
ATCATTGCATACTGCATATTCTCTCTTCAGGATGTGGCTTATGCTGAGgtattttctcta
tgggctgtcagcgacaggaagtatggtggattaagcttttcttcccaagatgtgggtagt
gtccttgcattctcagGTCTCTTCCTCCTGGTATTCCAAATTTTGGTTTACCCGTCAGTG
GCAAAATCAGTAGAGCCCATCACGCTTGTCCGTATAGTGGCAATATTGACTATACCACTT
CTTTCTAGCTATCCATTTATGGCCGGATTGTCAGGGTCCATTCTTCAATTGATAGTTAAC
TGTGCATCTTTTCTGAAGAATGCTTTTGCAGTTACTACCATCACTGTATTCAACATCTTA
ATGAATGATGCTGTGGCTCAGGACGTTAGAGCTTCAGCCAACGGTGTTGCTGTAACTCTG
ATGTCCATCTTTAAAGCTATTGCTCCAGCAATTGCAGGAGCTATATTTGCATGGGCTCAA
AGGCGTCAGACAGCTTCATTTCTCCCAGGCGACCACCTGGTATTCTTCATGCTGAACGTC
TTCACAGTCATCGGTCTTGTGAGCACTTTCAGGCCGTTTTACGCTAGAAGAAGCACGAAG
CACGATCCCATTACTACTTAG

Protein

486 aa

>Os01t0268100-01 Similar to Major facilitator superfamily antiporter.
MVGGGAGEPLRRAWGYHPECPGCRVDRRKEEREGIPYTELSLIWLVTVSSTLPIQSLFPF
LYFMIRDLHIAKQEEDIGFYAGFVGASYMFGRALSSVIWGIVADKYGRKPIIIITLISII
IFNTLFGLSSSYWMALTSRGLLGLMCGILGPIKAYATEVCRKEHGHLGLSLVSSSRGIGL
IVGPAIGGYLAQPADKYPSIFSEKSIFGRFPYFLPCLCISLLAIVALLASFWLPETLHKH
TQDMVLEDSISVEEGLSGPTAEENSAGCLNLFTNWPLMSAIIAYCIFSLQDVAYAEVFSL
WAVSDRKYGGLSFSSQDVGSVLAFSGLFLLVFQILVYPSVAKSVEPITLVRIVAILTIPL
LSSYPFMAGLSGSILQLIVNCASFLKNAFAVTTITVFNILMNDAVAQDVRASANGVAVTL
MSIFKAIAPAIAGAIFAWAQRRQTASFLPGDHLVFFMLNVFTVIGLVSTFRPFYARRSTK
HDPITT*

5'UTR

chr01:9211563..9211643 (- strand) : 81 bp

CDS

chr01:9211412..9211562 (- strand) : 151 bp

chr01:9210185..9210225 (- strand) : 41 bp

chr01:9209489..9209549 (- strand) : 61 bp

chr01:9209246..9209348 (- strand) : 103 bp

chr01:9209028..9209130 (- strand) : 103 bp

chr01:9208882..9208935 (- strand) : 54 bp

chr01:9208715..9208777 (- strand) : 63 bp

chr01:9208332..9208381 (- strand) : 50 bp

chr01:9208181..9208256 (- strand) : 76 bp

chr01:9207725..9207910 (- strand) : 186 bp

chr01:9207492..9207579 (- strand) : 88 bp

chr01:9207003..9207088 (- strand) : 86 bp

chr01:9206805..9206912 (- strand) : 108 bp

chr01:9206565..9206609 (- strand) : 45 bp

chr01:9206345..9206433 (- strand) : 89 bp

chr01:9205725..9205768 (- strand) : 44 bp

chr01:9204448..9204560 (- strand) : 113 bp

3'UTR

chr01:9204377..9204447 (- strand) : 71 bp

FASTA

>Os01t0268100-01 class=Sequence position=chr01:9204377..9211643 (- strand)
GATCCAGGGG GGGGGGGTGG TGAAGAGCTA GAGCTGGCGG CGGGTTGTTG AGGAGCGGCT GACTGAGGGG AGACCAGACC
AATGGTTGGC GGCGGGGCGG GCGAGCCGCT GAGGAGGGCG TGGGGGTACC ACCCCGAGTG CCCCGGATGC AGGGTGGACA
GGAGGAAGGA GGAGAGGGAG GGGATCCCCT ACACGGAGCT CTCCCTCATC TGGCTCGTCA CCGTCTCCTC CAGTGAGTGT
TCATCGGCCT CGCGCCGCCT CTCTTCCCTG ACCTTGATCG ACCTGTAGTA GTGCTTCGTC TTTTCCGCCG TCTGTTTCTT
TTTTTTTCTT TTTTTTTTGG AAATTAGTGG AGGATAACGC CGTTCTTTCC TTCTTCTTCT TCTTTGTTTT GAAATTAGTG
GATGATGGTA TCGCTGTCGC CAATTCAATA CTTTGAACTT TTTCTAAGTC GAACtaacat tttcaataca aaacaaatat
attatcaaat atatttaatg ttaaatttaa taaaactaat tttgatatca taaatattgc taattttttc tataaaaaag
ctttaattaa gaaaaaaagt caaataaatt ataatataaa acggagggag taGTACTATC GTAGTGTTAT CATTGTTTCG
GTTCGTACTT TGTAGTACAA GTAGTACACA TGCATGTGTA TATCATGGTG TAATGGGGAT TCAATTAGTA TGGGTTTGTA
GGAGCATCTC GTTGCCCCGA GCTTTGGCAT GCCACGATCA TGCTCAACGC AGTAGATTTG CTCGGTGCTC TCGCGGGTAT
TCTCAGAATC TCCACTGTCA AATGCCACTG CCCACTGGGG ATTGGTGCAA AACCGCAAAC TTTGAAgagc aagtttaata
gtatagctaa ctactggcta caaatcatct atagccaatc taatagtcca ttcatacaat agcatatact acactattaa
tgtatagccc taccttcata cgcacataac gtactgagtc cgtgctagtt ggctacaaat ctgtagcccg ttttccttct
ctctcttctt ccctctccta cacatatgct tacagTTGCT ATTCTACTCG CTCTAAATTC AAAATCGACC AAGCGAACTT
CTATTCGCAC ATCCCGAATT CGAAAGACTT TTGACAGAAG GATAGTGCAC GTATGGTACC TGCACGTACA CTTAGGAAAT
GTACTTCTCG TTTTCTCTAA TCAAACACTG AGGCTTACTA AAATGTTTTC TCCATTTGCC TAATTTGCTC ATCTTGTTAG
GCCAGGAAAC TGATTTAAAG AAGATTAACT GCACATCTGT GTCCTATATC TTGCGATCTA TATCTTTATT GTTTATCAGG
ACCTGATATT ATTTGTCCCT TTCTTTCTTA ATTTGTCTTT CTCTGTTGCT CTTTGCAGCC CTGCCGATAC AATCCCTGTT
TCCCTTCTTG TATTTTATGG TGAGCAATTT TACTTGCTTT TTTTTAGAGG TGCAATATGA TGACATTTTG TTTCATGAGA
AGAGAAGAGT TACTAGCGTC ACTATCGATT TTACATTTGG ACTTAACAGC TGTGCTGGAT CTGTAGTATG TAAAAGGTAA
AAATAAAAAT TAATATGCAC TGTCACATTG TAATTATTTC ATATATTGAG CCAAGGAAGA ACCAAATAGT AAATACTATA
Agagcaatgc tacacgtact aaatttttct tactaaactt ttactaacaa tcatctcaac cgtttgattt aagtagatgg
aagttacaaa aattctaggt gcactcatag catgacacat cagtgttagt aagaaaaagt tagtacgtat agccttttcc
ATACTATAAA CCTGGACACA TATCACCTTC ATTGTTGTAG TACCAAAAGA GCCATAATCT GACATCCTCT ATTACAATGA
TCGGTTAAAT ATTTCTCCTT AAATATGCGT CTTAGATATT CTATCGACAT TTTGTTTCCT TATTTGGTAT AGATTTGTCG
GAAACATAAC TTTTGAACGT AAAACAGCTT TGCAAATGCT GAACTGTGTT CTAAATTAAT TCTCTTTTAT CAACATTGGA
GTTTCTGTTT GCAGATAAGG GACCTGCATA TTGCTAAACA AGAAGAAGAT ATTGGATTTT ATGCTGGTTT TGTCGGTGAG
TTTTCTCTGA AACATATTTC CTCTTTTGCG TCAATCTGAG TAAGCACTTA AAAGTAGCTT CTAAGGATGT ATTATGAAAG
TGATAGCCTC AGCAAGGCAG CCTTATCTAA CAGGGTGAAC TTGTGATATG TGAAGGCGCT TCATATATGT TTGGAAGAGC
ACTCTCCTCT GTGATATGGG GCATCGTGGC TGATAAGTAC GGGAGGAAGC CGATTATTAT AATTACCCTT ATTTCAATGT
AAGGATCTTC GTTGAATGAA ACGTAGAATC CAATACTCTC ATCTATAAGC TTTTCGTTGG ATCTAATTTG TTAATGCACA
GAGAATTTGA GCACATTTTC TAATCTATTG CAGAATTATT TTCAATACAC TCTTTGGACT CAGCTCAAGT TATTGGATGG
CATTAACCTC AAGAGGTTTG CTTGGTCTGA TGTGTGGTAT ACTTGGCCCA ATTAAGGTAC CTGTGTCCAC ATGAGAATGC
TTCACTTTTG TCTATTAAAA CCTTCGACCA TGTTCTTGCA GCATTATTTT CTAATTTCTG TGTTCCAGGC CTATGCTACA
GAAGTGTGCC GAAAAGAACA CGGTCACCTT GGACTATCCC TTGTAAGATC TTGGACCATT ACTATTTCAA AATTTTCGTT
GTCTCCCAAC TTTGTTAGGC CCCCAATGTA ATGTTCACTG GTTGATATTG CTGGCTAATC TGTCAGGTTT CTTCCTCACG
TGGCATAGGC CTTATTGTGG GACCAGCTAT TGGTGGTTAT CTTGCACAGG TAATATTTTA TTTTAATATT TGAAGAAATC
ATGATGTAAT TAACTTGTAA CTATGTCAAG ATTATTGGCC CTTGTATTCC AATCATGACT CTTGCTAACC ATAGTCGCAA
ATTTCACAAA TTATAATACT TTAATGCGGT GTATCTAAAG TTTGGAGTTC TCTTGTCATA TACATTAATA ATTATACTCG
TCATGCCTCA AAAATTTGTG AAGAACATGA AAACACACAT GTTGATTATA TTGCTGCATC GAGGATAAAG TGCGATAGTT
TCATTTTTCT TTTATTGGCA TGCAACTCTA CTTATTTTGC TTGTGCCTTT CTGTTATACC AGCCTGCAGA TAAATATCCA
AGCATATTCT CTGAGAAGTC TATATTTGGG AGGTAGCATC TGCTTTCTAG ATCCATCTTG TATTGGTTGT TTCTTACACT
ACTAATTTTT AACGTGCAAT GTTTTAGGTT TCCGTATTTT CTCCCCTGCT TATGTATATC CCTCCTTGCC ATTGTTGCTC
TACTTGCTTC CTTCTGGCTC CCGGTGAGCA TTTTTCTTAT ATCCCTATGA TACAACATTT CTTTTAGCAA ACATCATTAT
AATAACTGCT TTCATTAAAT ATTTGATAAT TGATAACTCT GGTGAAATCC CATTTTGACA CTGGAATCAT AGTTCTTCAT
GATGATCCAT AAATTCATTT AGAATCTGCT GCTCAGTTGC AATTGCAACA TTAGTATTGA TGTGTACCCT GAGAACTTTG
CACAAAAACC TTAATGTCAC TGCACAAAAT TTGACATTTA CGTCATGTTA CAGGAAACTT TGCATAAGCA CACTCAGGAT
ATGGTTTTAG AGGATTCAAT TTCTGTAGAA GAAGGTCTTT CTGGTCCAAC TGCTGAAGAA AATAGTGCTG GATGTCTAAA
TTTATTCACA AACTGGCCAC TGATGTCTGC TATCATTGCA TACTGCATAT TCTCTCTTCA GGATGTGGCT TATGCTGAGG
TAATATTCTA CAGTGTCATT GGAGTTGCCT TTTGTTATTA TTTAGAATTT CATGCATCTT TTTTTTAATG TCATATTTGA
TTTTTGCACC ACCCCTCCTT TTTCTGTTAT TACTGGATTT CATTTGGGAA AACACAAATT GCaggtattt tctctatggg
ctgtcagcga caggaagtat ggtggattaa gcttttcttc ccaagatgtg ggtagtgtcc ttgcattctc aggtaCAGTA
AGCACAACAG GAAACCTCCC ACTAATATGG AGTTTTGAAT TTACAGGCAG ACTTATAAGA TTGTTCATCG AGATTTGAAA
TTTTGAACAC CGTGGACATG TGGATGTGAT AGGGATCTAA AGAAAGCACT AGCCCCATGA CCCCACATGC TATGGCTAAT
GCATATGATA ATGTAAAATT GTAAATTACC ATAATAAATA TATAATATGG ATATAGATCT TTTCTTATTG TTAGGTCTAG
TTTGATGTGA TCAATTGCAC TTTCTCAATT TGAAGTATTA ATTCTTGCTA AAACCAAATC TTAATCTGAA GTATGGTATG
AACTTGCTTA AAACTCAATT ATTCGTATTC CATGCAATGT CTGGTATATT GAGTACTGAC TTAACTTATT ATCAGGTCTC
TTCCTCCTGG TATTCCAAAT TTTGGTTTAC CCGTCAGTGG CAAAATCAGT AGAGCCCATC ACGCTTGTCC GTATAGTGGC
AGTAAGACTA TCTCTCTTTT TTTGGGTCAG AATTTAGATC AGCTCAGTTC TACTGTAACG GTTCAACTCA TATGATACTT
CTGAATTGCA GATATTGACT ATACCACTTC TTTCTAGCTA TCCATTTATG GCCGGATTGT CAGGGTCCAT TCTTCAATTG
ATAGTTAACT GTGCATCTTT TCTGAAGAAT GCTTTTGCAG TGAGTGCAAA CGTCTTGTGT TGTTTAGAAT GGATACTCGT
TTGGACAAGC GACTCGTTGT TTATTCATTT TTTTGAAACA ATTACTTCAA GTGTGGTCCT GTTTATTGTA TATCACTCTT
TTATATTTCA CCTCTCGACA CATCCATATT AGTTTTGACA AAATTCAACT CATGCTCTTC TAAAATTTTT TCAGGTTACT
ACCATCACTG TATTCAACAT CTTAATGAAT GATGCTGTGG TAAGTTCTTC AAGTTCCAAA TAATGTGTAC CGGGTAGTTA
TATAAAAAAT ATATTCTATT TTTCGGTTAT TATACGTGGT AATTTATAGT TTCTAATTTT GTTTTTCTAA CCATGAAATA
CAAATAACAG GCTCAGGACG TTAGAGCTTC AGCCAACGGT GTTGCTGTAA CTCTGATGTC CATCTTTAAA GCTATTGCTC
CAGCAATTGC AGGAGCTATG TAAGTATTTA TTATCTGTCT TTTTGCTCCC TGTTGCAATC ACAAAGGGAA GATAAAATAA
TTTAGTAAAA GTACAACTTT CCCTTAAATG GTTTTAGAGC ATACATGTAA TATATAGGAT AAATTCCTCA TATGCCACTG
AAATTTTATC CATTCCTTAT TTGTTAGTCA TGGTCTCAAT GACATGTGGG TCCAAGTCCT AGCCTATATG TTAGTGGGAC
GTCAATAACA AATAATGGAC CATTGAACCA CGTGAAATTT TCAGTGTGAA ATAAGGAATT TCCCTAGTTT TCTTGGACAA
ACAACAGTGT CCTTACAATT TCTTAGATAG TTATATTTCC TTTTGGTTAA TCAGTTTAAT TACAATGACA ATGAAACACA
ATTTTAGTTT TTTGTTTGTT GTGATCAACT CCCAATATTT TTGTTTTGCC ACATATTATT AGTAGTATTA ATTCATCAAG
ATATACAGCC AGGATTCACA CTTTGCAAAC TGTGGGTACC AGCTTTTTAT TATACATATA TGTTTTTTCA GGAGAAATAC
CGCATCGTAA TGCTAATTAC TCTTTTCCCT TATAGATTTG CATGGGCTCA AAGGCGTCAG ACAGCTTCAT TTCTCCCAGG
TATTACATGC ATGGTATATT ACTAGTGAAT TAACACGAAG ATACAACTTT GCTATATCCT ATCCCTGTTA ATACCAATGC
AATTAGCACT TTATCAGAAT TTTCTTAAAA TAATATATGG GAGAGCCACC TTATCATGTC AATAAGTTGG AAAGTTATGA
TACCAGAATA GAAAGAATGC AGTTCTGAAT GTTGGCAATG AACTCGCCAG ATATCAACAC CTTTAGAACA GATAATAACT
ATGAATGTGG TACATATATA AGAATAAGTT ATCTACCATT AGTTCTTTTA ATTATTTTTG CCCCTCTCAA TGCCATGAAT
ATCTGAATTG AATGATCAAA CTAGAGAAAT TTAAGCTTGC GTGTCTGTTT TAAGAATAAC TAGATATTGT TTGTCTAAAA
CTAATGGGAT AGAGTCTCTT AATGTTAGGT ACCAGCGAAG TTCATATCTT CATTTTTGAA GTAAGATCGT AAATACAGTA
GGTTCTTAGT TAAAAATTTA GAGTAAGATG TCTCATCTCT GTCTTTTGCG ATGTTCATTT GATATTTAAA ATAGGCAACA
TCGTAGACTA AAAAAAGAGT AAatttcaca aaactacaag tactttggct aaattattac aaaactacat atttaaggtg
aaatatcgaa aaactacaga tttagtaaca gagttatcac aaaactacag gattaagata aatttaatca caaaacttta
acatcataac tcaaacatag cattagtgct taaggattta aactctaaaa tctgtagttt tgtgatagtt ttattattaa
atttgtagtt tgcgatattt agccttaaac ctgtagtttt gtgatacatt aacttaaatt tgtagttttg taataattta
atcaaagtat ctatagtttt atgaaattta ctcAGAAAAA AAATCCAGAA ATATGCTGAT TTCAGGATCA CTATTCACTA
TTAAGCCCGA CCTTAGGATC TCTTCTGATA CCCCCCTTAA TTTCAACTAA GCTTATGTAT GCGTTTGAAA AGATTAAGCC
AGGTGGGTTG GCTTGTTGAA ATGCAACTAC GAAGAGGATT TCCTAAGCAT TGAAACGTTG TTGTATCCCA TTGATTCGTT
GTAAAGCTCT AATTCTGTTG GCACCTGCTC TCTGTTTTTG CAGGCGACCA CCTGGTATTC TTCATGCTGA ACGTCTTCAC
AGTCATCGGT CTTGTGAGCA CTTTCAGGCC GTTTTACGCT AGAAGAAGCA CGAAGCACGA TCCCATTACT ACTTAGCACT
AACCATTCTA CTCAGGACCT GAGGTCTGAt gtagaccccc atttttataa caggaatcac tcgtgtt

Locus: Os01g0268100

Loading...

Locus: Os01g0268100

Loading...