Os01t0273100-01

Locus

Os01g0273100

Description

Similar to Ubiquitin conjugating protein-like (Ubiquitin-conjugating enzyme) (Ubiquitinating enzyme).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

UBC27

CGSNL Gene Name

UBIQUITIN-CONJUGATING ENZYME 27

Oryzabase Gene Symbol Synonym(s)

OsUBC27

Oryzabase Gene Name Synonym(s)

Ubiquitin-conjugating enzyme 27

Transcript Evidence

AK105320 (DDBJ, Best hit)

Protein Evidence

NP_001149453.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: acid-amino acid ligase activity (GO:0016881)

Functional domain (InterPro)

Ubiquitin-conjugating enzyme, E2 (IPR000608)

Ubiquitin-conjugating enzyme/RWD-like (IPR016135)

Ubiquitin-conjugating enzyme, active site (IPR023313)

Full-length cDNA

001-117-G01 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0273100-01)

RiceXPro (AK105320)

Others

Oryzabase (19567)

KEGG (Os01t0273100-01 (EC:6.3.2.19))

Transcript

810 bp

>Os01t0273100-01 Similar to Ubiquitin conjugating protein-like (Ubiquitin-conjugating enzyme) (Ubiquitinating enzyme).
CTCCCTCTCTCTCTCTCTCTCTCTTCTCGAAGCGCCTCCACCGATCTCGAATTCTCTCGA
TCCAGGCAAGGAGGGAGGAGGATGGCGAGGGGCGAGAACAACACCGGCGCGCACGGCAGC
GGCAACGTGCCTCCTCCCGCCACCGCCGCGTCCACGGCGGCGGGGACGGCGGCCGCGTCC
GGGAAGCAGCAGGCGCGGGGGGCGGGGGCGGAGGGGCAGTCGGTGGTGCGGCGGCTGCAG
TCGGAGCTGATGGCGCTGATGATGGGCGGCGACCCGGGCGTGTCCGCGTTCCCGGAGGGG
GACAACATCTTCAGCTGGGTGGGCACCATCGCCGGGTCCGCCGCGACGGCGTACGAGGGC
ACCTCCTACCGCCTCTCCCTCGCCTTCCCCGGCGAGTACCCGTACAAGCCGCCCAAGGTG
AGGTTCGAAACCCCCTGCTTCCACCCAAACGTGGACGCCCACGGCAACATCTGCCTCGAC
ATCCTCCAGGACAAGTGGTCCTCCGCCTACGACGTCCGCACCATCCTCCTCTCCATCCAG
AGCCTCCTCGGCGAGCCCAACAACGACTCCCCCCTCAACACCCAGGCCGCCGCCCTCTGG
CCTAACCAGGACGAGTTCAGGAAGATGGTCGAGAAGCTCTACAAGCCCACCGCGTAGAAG
TTGGTGGCGCCTTCGCCCGGCGATCTGATCTGGCCTTCTCACCTTGAATCGATGATGATT
CGAATGCGATTGTTGTGCGAGTCGGATTGGAACTGTTCGATCTGTAATTTTTTTTTGTTG
GTTGTTTGAATGATTCATTTGTTTCGATGT

CDS

576 bp

>Os01t0273100-01 Similar to Ubiquitin conjugating protein-like (Ubiquitin-conjugating enzyme) (Ubiquitinating enzyme).
ATGGCGAGGGGCGAGAACAACACCGGCGCGCACGGCAGCGGCAACGTGCCTCCTCCCGCC
ACCGCCGCGTCCACGGCGGCGGGGACGGCGGCCGCGTCCGGGAAGCAGCAGGCGCGGGGG
GCGGGGGCGGAGGGGCAGTCGGTGGTGCGGCGGCTGCAGTCGGAGCTGATGGCGCTGATG
ATGGGCGGCGACCCGGGCGTGTCCGCGTTCCCGGAGGGGGACAACATCTTCAGCTGGGTG
GGCACCATCGCCGGGTCCGCCGCGACGGCGTACGAGGGCACCTCCTACCGCCTCTCCCTC
GCCTTCCCCGGCGAGTACCCGTACAAGCCGCCCAAGGTGAGGTTCGAAACCCCCTGCTTC
CACCCAAACGTGGACGCCCACGGCAACATCTGCCTCGACATCCTCCAGGACAAGTGGTCC
TCCGCCTACGACGTCCGCACCATCCTCCTCTCCATCCAGAGCCTCCTCGGCGAGCCCAAC
AACGACTCCCCCCTCAACACCCAGGCCGCCGCCCTCTGGCCTAACCAGGACGAGTTCAGG
AAGATGGTCGAGAAGCTCTACAAGCCCACCGCGTAG

Protein

192 aa

>Os01t0273100-01 Similar to Ubiquitin conjugating protein-like (Ubiquitin-conjugating enzyme) (Ubiquitinating enzyme).
MARGENNTGAHGSGNVPPPATAASTAAGTAAASGKQQARGAGAEGQSVVRRLQSELMALM
MGGDPGVSAFPEGDNIFSWVGTIAGSAATAYEGTSYRLSLAFPGEYPYKPPKVRFETPCF
HPNVDAHGNICLDILQDKWSSAYDVRTILLSIQSLLGEPNNDSPLNTQAAALWPNQDEFR
KMVEKLYKPTA*

5'UTR

chr01:9445685..9445765 (+ strand) : 81 bp

CDS

chr01:9445766..9446341 (+ strand) : 576 bp

3'UTR

chr01:9446342..9446494 (+ strand) : 153 bp

FASTA

>Os01t0273100-01 class=Sequence position=chr01:9445685..9446494 (+ strand)
CTCCCTCTCT CTCTCTCTCT CTCTTCTCGA AGCGCCTCCA CCGATCTCGA ATTCTCTCGA TCCAGGCAAG GAGGGAGGAG
GATGGCGAGG GGCGAGAACA ACACCGGCGC GCACGGCAGC GGCAACGTGC CTCCTCCCGC CACCGCCGCG TCCACGGCGG
CGGGGACGGC GGCCGCGTCC GGGAAGCAGC AGGCGCGGGG GGCGGGGGCG GAGGGGCAGT CGGTGGTGCG GCGGCTGCAG
TCGGAGCTGA TGGCGCTGAT GATGGGCGGC GACCCGGGCG TGTCCGCGTT CCCGGAGGGG GACAACATCT TCAGCTGGGT
GGGCACCATC GCCGGGTCCG CCGCGACGGC GTACGAGGGC ACCTCCTACC GCCTCTCCCT CGCCTTCCCC GGCGAGTACC
CGTACAAGCC GCCCAAGGTG AGGTTCGAAA CCCCCTGCTT CCACCCAAAC GTGGACGCCC ACGGCAACAT CTGCCTCGAC
ATCCTCCAGG ACAAGTGGTC CTCCGCCTAC GACGTCCGCA CCATCCTCCT CTCCATCCAG AGCCTCCTCG GCGAGCCCAA
CAACGACTCC CCCCTCAACA CCCAGGCCGC CGCCCTCTGG CCTAACCAGG ACGAGTTCAG GAAGATGGTC GAGAAGCTCT
ACAAGCCCAC CGCGTAGAAG TTGGTGGCGC CTTCGCCCGG CGATCTGATC TGGCCTTCTC ACCTTGAATC GATGATGATT
CGAATGCGAT TGTTGTGCGA GTCGGATTGG AACTGTTCGA TCTGTAATTT TTTTTTGTTG GTTGTTTGAA TGATTCATTT
GTTTCGATGT 

Locus: Os01g0273100

Loading...

Locus: Os01g0273100

Loading...