Os01t0273800-01

Locus

Os01g0273800

Description

YUCCA protein, Indole-3-acetic acid (IAA) biosynthesis, Control of IAA production in developing rice grain

RAP-DB Gene Symbol Synonym(s)

OsYUC9

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

YUCCA9

CGSNL Gene Name

YUCCA-LIKE GENE 9

Oryzabase Gene Symbol Synonym(s)

OsYUCCA9, OsYUC9, YUC9

Oryzabase Gene Name Synonym(s)

(YUCCA-like gene)

Transcript Evidence

AK109645

Protein Evidence

Q9SDE9

Literature

PMID: 22582989

Note

Manual Curation

June 22, 2022

Gene Ontology (GO)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: N,N-dimethylaniline monooxygenase activity (GO:0004499)

Molecular Function: flavin adenine dinucleotide binding (GO:0050660)

Molecular Function: NADP binding (GO:0050661)

Functional domain (InterPro)

FAD/NAD(P)-binding domain superfamily (IPR036188)

Flavin monooxygenase FMO (IPR000960)

Full-length cDNA

002-138-H02 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0273800-01)

RiceXPro (AK109645)

Others

Oryzabase (8179)

KEGG (Os01t0273800-01)

Transcript

1384 bp

>Os01t0273800-01 YUCCA protein, Indole-3-acetic acid (IAA) biosynthesis, Control of IAA production in developing rice grain
ACCTCTCTCTCGATTCACCACGGCGGCGACGGCAATGGCGGCGGTGGAGCAGGATCAGGA
GGAGGAGGTGAtcatcgtcggggcggggccgtcggggctcgcggcggcggcgtgcctgtc
ggtgcgcggcgtgacgggctgcctcgtcctggagcgcgacgactgcgtggcgtcgctgtg
gcgccaccgcacctacgaccgcgtccgcctccacctcgccaagcgctactgcgcgctccc
gcacgcgccgcacggcgaggcgtcgccgacctacctcccccgcgacgacttcctccgcta
cctcgacgcctacgcctcccgcttcggcgtccgcgcccgcctccgccgcgaggtccgctc
ggcgcgctacgacgccgcccgcgcccggtggctcgtcgacgccgtcgacctcgccacggg
acgcgcggagcggtacgcggcgaggcacctggtcgccgccgcgggcgagaacgacgagag
ggtggtgcccgaggtgcccgggatggagacgttccccgggaaggtggtgcacgccgccga
ctaccggagcgcggaggggttcaaggggaagtccgtgctcgtcgtcggcggcggcaactc
cggcatggagatcgcctacgacctcgccgtcggcggcgccgccacctccatcgtcatccg
cagcgagCTGCACCTGGTGAGCAAGGAGATATGGAACTTGGCGATGACGCTGTACAGGTA
CCTGCCGGTGTGGGTGATCGACAAGGTGGTGCTGCTCATGTGCGCCGCCGTGTTCGGCGA
CACCGCCCGCTACGGCCTCCGGCGGCCGGCCGTCGGGCCCTTCACCATGAAGGCCACCAC
CACGATGTACCCGGTCGTGGACGTCGGCACCTTCGCCAAGATCAGGTCCGGCGAGATCCG
CGTCCTCCCGGCCGCCATCAAGGGCGTCCGCGGCCGCGACGTCGAGTTCGCCGACGGCCA
GCGCCACGCCTTCGACGCCGTCGTCTTCGCCACCGGCTACCGGAGCACCACCAAGCACTG
GCTCAAGAGTGATGACGGGCTGATCGGCGACGACGGGATGGCGGGGCGGAGCTACCCGGA
TCACTGGAAGGGGGAGAACGGGCTGTACTGCGCCGGGATGGTGAGGAGGGGAATCTACGG
CAGCTACGAGGACGCGGAGCACATCGCCGACGACATCAGCAAGCAACTCCGGAGCAGCAG
CAAGCCTACCCACAACAATGGCTCGGCCTAGAAAGAAATTAAATCAAGCTGATGAGGCTC
TCCCCCTTGGACCTTGTCTTGGTTATTATATTAGGTGTAGCTTTTATACTATGATTTTGT
TTCTGAGTTTGTGGATGTGGATGAAATAAACAAAATAAAACTTGCCCTTGGGTGGTCTTT
GATT

CDS

1197 bp

>Os01t0273800-01 YUCCA protein, Indole-3-acetic acid (IAA) biosynthesis, Control of IAA production in developing rice grain
ATGGCGGCGGTGGAGCAGGATCAGGAGGAGGAGGTGAtcatcgtcggggcggggccgtcg
gggctcgcggcggcggcgtgcctgtcggtgcgcggcgtgacgggctgcctcgtcctggag
cgcgacgactgcgtggcgtcgctgtggcgccaccgcacctacgaccgcgtccgcctccac
ctcgccaagcgctactgcgcgctcccgcacgcgccgcacggcgaggcgtcgccgacctac
ctcccccgcgacgacttcctccgctacctcgacgcctacgcctcccgcttcggcgtccgc
gcccgcctccgccgcgaggtccgctcggcgcgctacgacgccgcccgcgcccggtggctc
gtcgacgccgtcgacctcgccacgggacgcgcggagcggtacgcggcgaggcacctggtc
gccgccgcgggcgagaacgacgagagggtggtgcccgaggtgcccgggatggagacgttc
cccgggaaggtggtgcacgccgccgactaccggagcgcggaggggttcaaggggaagtcc
gtgctcgtcgtcggcggcggcaactccggcatggagatcgcctacgacctcgccgtcggc
ggcgccgccacctccatcgtcatccgcagcgagCTGCACCTGGTGAGCAAGGAGATATGG
AACTTGGCGATGACGCTGTACAGGTACCTGCCGGTGTGGGTGATCGACAAGGTGGTGCTG
CTCATGTGCGCCGCCGTGTTCGGCGACACCGCCCGCTACGGCCTCCGGCGGCCGGCCGTC
GGGCCCTTCACCATGAAGGCCACCACCACGATGTACCCGGTCGTGGACGTCGGCACCTTC
GCCAAGATCAGGTCCGGCGAGATCCGCGTCCTCCCGGCCGCCATCAAGGGCGTCCGCGGC
CGCGACGTCGAGTTCGCCGACGGCCAGCGCCACGCCTTCGACGCCGTCGTCTTCGCCACC
GGCTACCGGAGCACCACCAAGCACTGGCTCAAGAGTGATGACGGGCTGATCGGCGACGAC
GGGATGGCGGGGCGGAGCTACCCGGATCACTGGAAGGGGGAGAACGGGCTGTACTGCGCC
GGGATGGTGAGGAGGGGAATCTACGGCAGCTACGAGGACGCGGAGCACATCGCCGACGAC
ATCAGCAAGCAACTCCGGAGCAGCAGCAAGCCTACCCACAACAATGGCTCGGCCTAG

Protein

398 aa

>Os01t0273800-01 YUCCA protein, Indole-3-acetic acid (IAA) biosynthesis, Control of IAA production in developing rice grain
MAAVEQDQEEEVIIVGAGPSGLAAAACLSVRGVTGCLVLERDDCVASLWRHRTYDRVRLH
LAKRYCALPHAPHGEASPTYLPRDDFLRYLDAYASRFGVRARLRREVRSARYDAARARWL
VDAVDLATGRAERYAARHLVAAAGENDERVVPEVPGMETFPGKVVHAADYRSAEGFKGKS
VLVVGGGNSGMEIAYDLAVGGAATSIVIRSELHLVSKEIWNLAMTLYRYLPVWVIDKVVL
LMCAAVFGDTARYGLRRPAVGPFTMKATTTMYPVVDVGTFAKIRSGEIRVLPAAIKGVRG
RDVEFADGQRHAFDAVVFATGYRSTTKHWLKSDDGLIGDDGMAGRSYPDHWKGENGLYCA
GMVRRGIYGSYEDAEHIADDISKQLRSSSKPTHNNGSA*

5'UTR

chr01:9488825..9488858 (+ strand) : 34 bp

CDS

chr01:9488859..9489491 (+ strand) : 633 bp

chr01:9492630..9492989 (+ strand) : 360 bp

chr01:9493608..9493811 (+ strand) : 204 bp

3'UTR

chr01:9493812..9493964 (+ strand) : 153 bp

FASTA

>Os01t0273800-01 class=Sequence position=chr01:9488825..9493964 (+ strand)
ACCTCTCTCT CGATTCACCA CGGCGGCGAC GGCAATGGCG GCGGTGGAGC AGGATCAGGA GGAGGAGGTG Atcatcgtcg
gggcggggcc gtcggggctc gcggcggcgg cgtgcctgtc ggtgcgcggc gtgacgggct gcctcgtcct ggagcgcgac
gactgcgtgg cgtcgctgtg gcgccaccgc acctacgacc gcgtccgcct ccacctcgcc aagcgctact gcgcgctccc
gcacgcgccg cacggcgagg cgtcgccgac ctacctcccc cgcgacgact tcctccgcta cctcgacgcc tacgcctccc
gcttcggcgt ccgcgcccgc ctccgccgcg aggtccgctc ggcgcgctac gacgccgccc gcgcccggtg gctcgtcgac
gccgtcgacc tcgccacggg acgcgcggag cggtacgcgg cgaggcacct ggtcgccgcc gcgggcgaga acgacgagag
ggtggtgccc gaggtgcccg ggatggagac gttccccggg aaggtggtgc acgccgccga ctaccggagc gcggaggggt
tcaaggggaa gtccgtgctc gtcgtcggcg gcggcaactc cggcatggag atcgcctacg acctcgccgt cggcggcgcc
gccacctcca tcgtcatccg cagcgaggtc agctagCTTG CTTAGCTCTT GTCTCCTATA CTAGCTTAAT TATAATTAAT
TCGTTTCAAT CGTTTCCAAA TTAAATTCGA TTTGCCATTA AAACGAGCGA ATTTCAAGCT CTGTTTATTT GTCCCTCGTT
TAATTTGCTT ATAATTAATT ATTTTTGATT TACCAATTAA TTAATCGAAT TTGTACCTTA AAAAAATTAT ACGACCGAAT
CGAATATTTG GTACTAGTAT AATTGTTATT TGACCAAATT TGGTAGGGCC GGGCCAATTA ATAACATCCT AGCCACCTTA
AAAGAGCTAG ATTTGCCAAT AATTTTCGTA ACATTCTTAT TATTTGCTAG TATACCAACC CCTGGCCCCA CACGCTAGTG
AGAATGAGAA AAGCTATTTT TTTTTTGTAT TTTCTTTGGT ACCAATTAAT CCATGGCCCC ACATGCCAGT GAGTGAGAGT
ACCCGTGCTT GATCAGTTGA TCGGTGAGGA AGTACCTTGA ATTAATTTAC GACCATCGGA TCGCCTAACG GACGGCTAGG
ATCGAGTAAT CAAGCTGAGT AATTAATTAA CCATAATTAG TTACTGACAG AGATCTTAAA GAGGGATTAA TTAGCAGTGG
ACGCGGCGGG CTCCTGACCG TGATTAAGCT CTGTAATTAA TTAAAACCAT CCACGTTTTC TTCCTTTCCA ATGGATCGAT
CAGTACATGT GGTTATTAAT CACCAGGGTT AATTACTTCA TTACTCCCTA GTGTTGCTGG TACTACGTAG TAGTAGCGAT
TAATTAAGAC ATGACGACGC AACAGTCCAA ATTCTTTCAG TGTGGTCCTA AGCTACCATC AGTACTGATG AAACATGACA
AATAGAGAAA CTCCAACTAA CTTTGAAATG AAACAAAAAA ACACACGTAC GGAGATCGAA ATTGATCCCC AAACACCAAC
ATTACAGGTT TACATTAATG GTCTATATGA AAAAAAATTA AAAAAGAGAC AGAGTATAAT ATGCCAATAA ATTCGGTGAA
TAGAAGGTGT GACCACAAAT AAGACGACGT ATATTTAATT AGGACATGGG ACGTATTTAG AACAGAAATA ACCACACAAT
CTATTCAATG GTAAAATGTG TACCCACGCC GCTATATATA TAAGGTTAAT TAGTCCTTAA TTTAGTCTCT TTAGACTGTG
CTAGCTAGAA TATAATCATG TACAGGTGTT TGTAGGCGTG AGTAATTAAG TGTGTGCATC CTGACGTGTA TTTTGGGCAA
CCAACATGAA AGCTGTTTTT TTTTTTAAAA CTTGGGCTCT TTAATTCCAG AGGACTCGAA AGTGGAAATA AATTAAACAA
TTAAACCAAC AACCTGGCAG AGAATTTCGT TGCTGTATGA TTAATTACAG TAGTGTGCAT GCTTATTGCA AATTTTATTA
GACCCAACCA TATAAAATGG TATCCGAGAG CTATATCGTG GGCGGCGCCA TGTAAAAGTA TAAATAACTT GACTATATAT
ATATATATAT ATATATATAT ATATATATAT ATATATATAT ATATATATAT ATATATTCAT CGTCGCTGGC ACATGGCCTG
GTCTCTCTCG AACTCTGACA TCACGTGCAG GCAAATTAAA CACATCATCG ATCGATCAGA CTACACAATG ATTTTGCTCC
TAATTAATCT CAGCCGGAGA CCGCAGCTGA TTAAATGCGT AATGTAATTC AGGTCAGGTT GCATGCATGC AGCATAGGAT
CCGATGATTA TTTTGCTTAA AAACATCATT AACTCGATTG TTATCAATCA CATCACAAGC ATATATATGT GGCTCGATCC
AGTATACGTA CGTTCATCTC TCTGTATGTA TGTCGTACGT ATATACTGTA CCGTACGTGC GTCATCGTCA TCAGGAGGGA
AAAAAACACG TTACACGTGC ACGCCTTTGT CTGATTTTCG CATGGCGACG CCAGATCCAC GCAGGCATAT CATAGTCCGT
CCAGCGTCCC TCCGGACGGC CTGGGATCCT GTCCTCTAGT ATTTTCTTGT TCCAATTATT AGGGGAGCCC TCTATTTGCG
GCTCTATTTG ATTCGGGCTA AATATAACTA TACGTAGACA GAAAGTTATT Cctccctcca ttctaaaata taagatataa
ctaccattaa cccaaaaact aagaaataat tattatcgca tcgtagttta gattacccta ataaatagaa tacatgcacc
caataaaatt agagatcttg ttgatggagg atttaaataa tattattata ataaaaaaag atgggctagt taatgacata
catgcatata cgccttatat tatgaaataa cttgaaacaa ctttaaaaat tagttacgcc ttatattatg gaatggaggg
agtaTATCTC TACTTATTTA AATGTAGTGT GGTTATCCTT CTTTTTTTTT TCCTTCTTAC CGTGTGCCAA AAGTCGTACG
GTCCTTCGTG TGTGCGTAAT TACCGTAGGA TCTAGTTTCA GAGATGTCAG TAATAATATC ATTAATTAAT TAAAATTTTT
AATGTAACTA GTCTTTGATT AATCACTATA CATCTGTTGG TTTAGACATC AACACAACGT TCTATAATAT CCATGGaact
agcatattga ccgtgcgttg taacgtgatt ttaatcaaat aaaaaattat cactaagatg ttattatcat ctcttaattg
atgtatatat atttgttact gacatatgaa tcctttagta ctacactatt acttttcctt cttataaaaa acatatagtt
ggtgggagtg gttgacatat aggtcctcta gacccacatg ccatttttgc taaaaagaaa agttAGGAGT TGGTGGGGGG
TCGGTGGCGG AACAAGAACC ACCACTACTC GAGTATAGAT AAACTTTTTT TTAAAAAATA AAAATATAAT TATATGAAAG
AGCTTTTTAT GAAAAATCTA TTAATATAAA ATTTCATTTT GATTTTTTAA AATATTTTAA TATTTAGTAA TGATTTAAGA
TTTCGAGATT TTTTCTACAC GCATAACTGT AGTACGTCGT CCTTACTCCT TAGCGAGGTA ATCTCAGTGA CCATTCTGGT
TAATCATGCA ATCTAAATTG CAACCAATTA ATTAATCGAT CGCAGCTGCA CCTGGTGAGC AAGGAGATAT GGAACTTGGC
GATGACGCTG TACAGGTACC TGCCGGTGTG GGTGATCGAC AAGGTGGTGC TGCTCATGTG CGCCGCCGTG TTCGGCGACA
CCGCCCGCTA CGGCCTCCGG CGGCCGGCCG TCGGGCCCTT CACCATGAAG GCCACCACCA CGATGTACCC GGTCGTGGAC
GTCGGCACCT TCGCCAAGAT CAGGTCCGGC GAGATCCGCG TCCTCCCGGC CGCCATCAAG GGCGTCCGCG GCCGCGACGT
CGAGTTCGCC GACGGCCAGC GCCACGCCTT CGACGCCGTC GTCTTCGCCA CCGGCTACCG GAGCACCACC AAGCACTGGC
TCAAGGTAAT TGTAATTAAT TAATAAGTTA ATTAATTGAA CAGTACTGTG TTAATTGTTT GCATCATGAT TCGTACGTGC
GGCGACACAA TTAATTATTG CTGCTCCCGG CCGTATGCAT ATTCCTATTT GGAAAAGTCT GAGGCTTTGG CATGAAGCAA
AGCTCGACAA GGTCTCAACT TTCAGCAGCA TACACCTCAT GCTGAACGTA CATACTGAtc cgtctcgtaa tataaagtat
tttttgatgg atgtgacaca tcctaatata atatttgtcc agattaatta aatcaggatg tgttacatct atccaaaatc
ccttatatta tgagacgagg tagTACATGT TTTTCGAATA ATATATCAGC GATAGCTAGT GTGGCTTATG ACAACATTTT
TTTTTCAATC CGAAACACAC AAAAGCTTTA CATGTTATTT AACCATCAAC AATAAAAGCT CTAATATTTT TGTTTTTTTA
AAAAACAGAA TGGCACATTA AAAATCATGT TTTAATTAAC CTTATTGTAC GATCTTAACT ATGCCATATG CTAGATAGTA
CCTTATTTAT ATATTTTACA TATGTTTTCT AACATTTGTG TGTAATTAAA TTTAATTTTA TAGAGTGATG ACGGGCTGAT
CGGCGACGAC GGGATGGCGG GGCGGAGCTA CCCGGATCAC TGGAAGGGGG AGAACGGGCT GTACTGCGCC GGGATGGTGA
GGAGGGGAAT CTACGGCAGC TACGAGGACG CGGAGCACAT CGCCGACGAC ATCAGCAAGC AACTCCGGAG CAGCAGCAAG
CCTACCCACA ACAATGGCTC GGCCTAGAAA GAAATTAAAT CAAGCTGATG AGGCTCTCCC CCTTGGACCT TGTCTTGGTT
ATTATATTAG GTGTAGCTTT TATACTATGA TTTTGTTTCT GAGTTTGTGG ATGTGGATGA AATAAACAAA ATAAAACTTG
CCCTTGGGTG GTCTTTGATT 

Locus: Os01g0273800

Loading...

Locus: Os01g0273800

Loading...