Os01t0274100-00

Locus

Os01g0274100

Description

Similar to disulfide oxidoreductase/ monooxygenase/ oxidoreductase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

YUCCA10

CGSNL Gene Name

YUCCA-LIKE GENE 10

Oryzabase Gene Symbol Synonym(s)

OsYUCCA10, OsYUC10

Oryzabase Gene Name Synonym(s)

Transcript Evidence

ab initio prediction

Protein Evidence

NP_001147115.1 (RefSeq)

Literature

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: flavin-containing monooxygenase activity (GO:0004499)

Molecular Function: oxidoreductase activity (GO:0016491)

Molecular Function: flavin adenine dinucleotide binding (GO:0050660)

Molecular Function: NADP binding (GO:0050661)

Functional domain (InterPro)

Pyridine nucleotide-disulphide oxidoreductase, class-II (IPR000103)

FAD-dependent pyridine nucleotide-disulphide oxidoreductase (IPR013027)

Flavin monooxygenase-like (IPR020946)

Expression Databases

TENOR (Os01t0274100-00)

Others

Oryzabase (9108)

Transcript

1236 bp

>Os01t0274100-00 Similar to disulfide oxidoreductase/ monooxygenase/ oxidoreductase.
ATGGCGGTGGCGGCGGAGGGTGAGGAGATGACACCGGAGCACGAGGAAGAGGTGAtcatc
gtgggcgccgggcagtccgggctggccgcggcggcgtgcctgtcggtgcgcggcgtggcg
agctgcctcgtcctggagcgcgacgactgcgtggcgtcgctgtggcgccaccgcgcctac
gaccgcctccgcctccacctccccaagcgccactgcgcgctgccgcgcgcgccgcacgcc
gccgccgcgcccgactacctcccccgcgacgacttcgccgcctacctcgacgcctacgcc
tcccgcttcggcgtccgcacccgcctccgccgcgaggtccgctcggcgcgccacgacgcc
gcccgcgccaggtggctcgtcgaagccgtcgacctcgccacggggaaggcggagcggtac
gcggcgaggcacctcgtcgccgccgcgggcgagaacgacgagagggtggtgcccgaggtg
cccggcatggacacgttccccggcaaggtcgtccactccgccgactaccgctcggccggc
gcgttcaaggggaggtccgtgctcgtcgtcggctgcggcaactccggctttgagatcgcc
tacgacctcgccgccggcggcgccgccgccgtctccatcgccgtgcgcGGCGAGGTGCAC
CTGGTGAgccgggaggtctggagcgtggggatggcgctgcagaggtacctgccgacgtgg
gcggtggacaaggttgtgctgctcatgtgcgccgtcgtgttcggcggcgacaccgcgcgg
tacgggctccggcggccggccgtcgggccgttctccatgaAGATGACCACGCCGGCGTAC
CCGGTGTTCGACGTCGGCACCTTCGCCAAGATCAGGTCCGGGGAGATCCGCGTCGTGCCG
GCCGGCATCAAGAGCGTCCGCGGcggcgacgtcgagttcgccgacggccggcgccacgcc
ttcgacgccatcGTCTTCGCCACCGGTTACCGGAGCACCACCAAGCAGTGGCTCAAGAGC
GATGACGGGCTGATCGGCGACGACGGGATGGCGGGGCGGAGCTACCCGGATCACTGGAAG
GGGGAGAACGGGCTGTACTGCGCCGGGATGGTGAGGAGGGGAATCTACGGCAGCGGCGAG
GACGCGGAGCTCATCGCCGACGACATCAGCAAGCAGATGAAGCGCTGGAGCAGCGAGCCC
GTCTACAATGGCCACATCAGCAACGGATCCCCCTAA

CDS

1236 bp

>Os01t0274100-00 Similar to disulfide oxidoreductase/ monooxygenase/ oxidoreductase.
ATGGCGGTGGCGGCGGAGGGTGAGGAGATGACACCGGAGCACGAGGAAGAGGTGAtcatc
gtgggcgccgggcagtccgggctggccgcggcggcgtgcctgtcggtgcgcggcgtggcg
agctgcctcgtcctggagcgcgacgactgcgtggcgtcgctgtggcgccaccgcgcctac
gaccgcctccgcctccacctccccaagcgccactgcgcgctgccgcgcgcgccgcacgcc
gccgccgcgcccgactacctcccccgcgacgacttcgccgcctacctcgacgcctacgcc
tcccgcttcggcgtccgcacccgcctccgccgcgaggtccgctcggcgcgccacgacgcc
gcccgcgccaggtggctcgtcgaagccgtcgacctcgccacggggaaggcggagcggtac
gcggcgaggcacctcgtcgccgccgcgggcgagaacgacgagagggtggtgcccgaggtg
cccggcatggacacgttccccggcaaggtcgtccactccgccgactaccgctcggccggc
gcgttcaaggggaggtccgtgctcgtcgtcggctgcggcaactccggctttgagatcgcc
tacgacctcgccgccggcggcgccgccgccgtctccatcgccgtgcgcGGCGAGGTGCAC
CTGGTGAgccgggaggtctggagcgtggggatggcgctgcagaggtacctgccgacgtgg
gcggtggacaaggttgtgctgctcatgtgcgccgtcgtgttcggcggcgacaccgcgcgg
tacgggctccggcggccggccgtcgggccgttctccatgaAGATGACCACGCCGGCGTAC
CCGGTGTTCGACGTCGGCACCTTCGCCAAGATCAGGTCCGGGGAGATCCGCGTCGTGCCG
GCCGGCATCAAGAGCGTCCGCGGcggcgacgtcgagttcgccgacggccggcgccacgcc
ttcgacgccatcGTCTTCGCCACCGGTTACCGGAGCACCACCAAGCAGTGGCTCAAGAGC
GATGACGGGCTGATCGGCGACGACGGGATGGCGGGGCGGAGCTACCCGGATCACTGGAAG
GGGGAGAACGGGCTGTACTGCGCCGGGATGGTGAGGAGGGGAATCTACGGCAGCGGCGAG
GACGCGGAGCTCATCGCCGACGACATCAGCAAGCAGATGAAGCGCTGGAGCAGCGAGCCC
GTCTACAATGGCCACATCAGCAACGGATCCCCCTAA

Protein

412 aa

>Os01t0274100-00 Similar to disulfide oxidoreductase/ monooxygenase/ oxidoreductase.
MAVAAEGEEMTPEHEEEVIIVGAGQSGLAAAACLSVRGVASCLVLERDDCVASLWRHRAY
DRLRLHLPKRHCALPRAPHAAAAPDYLPRDDFAAYLDAYASRFGVRTRLRREVRSARHDA
ARARWLVEAVDLATGKAERYAARHLVAAAGENDERVVPEVPGMDTFPGKVVHSADYRSAG
AFKGRSVLVVGCGNSGFEIAYDLAAGGAAAVSIAVRGEVHLVSREVWSVGMALQRYLPTW
AVDKVVLLMCAVVFGGDTARYGLRRPAVGPFSMKMTTPAYPVFDVGTFAKIRSGEIRVVP
AGIKSVRGGDVEFADGRRHAFDAIVFATGYRSTTKQWLKSDDGLIGDDGMAGRSYPDHWK
GENGLYCAGMVRRGIYGSGEDAELIADDISKQMKRWSSEPVYNGHISNGSP*

CDS

chr01:9512985..9514001 (+ strand) : 1017 bp

chr01:9514884..9515102 (+ strand) : 219 bp

FASTA

>Os01t0274100-00 class=Sequence position=chr01:9512985..9515102 (+ strand)
ATGGCGGTGG CGGCGGAGGG TGAGGAGATG ACACCGGAGC ACGAGGAAGA GGTGAtcatc gtgggcgccg ggcagtccgg
gctggccgcg gcggcgtgcc tgtcggtgcg cggcgtggcg agctgcctcg tcctggagcg cgacgactgc gtggcgtcgc
tgtggcgcca ccgcgcctac gaccgcctcc gcctccacct ccccaagcgc cactgcgcgc tgccgcgcgc gccgcacgcc
gccgccgcgc ccgactacct cccccgcgac gacttcgccg cctacctcga cgcctacgcc tcccgcttcg gcgtccgcac
ccgcctccgc cgcgaggtcc gctcggcgcg ccacgacgcc gcccgcgcca ggtggctcgt cgaagccgtc gacctcgcca
cggggaaggc ggagcggtac gcggcgaggc acctcgtcgc cgccgcgggc gagaacgacg agagggtggt gcccgaggtg
cccggcatgg acacgttccc cggcaaggtc gtccactccg ccgactaccg ctcggccggc gcgttcaagg ggaggtccgt
gctcgtcgtc ggctgcggca actccggctt tgagatcgcc tacgacctcg ccgccggcgg cgccgccgcc gtctccatcg
ccgtgcgcGG CGAGGTGCAC CTGGTGAgcc gggaggtctg gagcgtgggg atggcgctgc agaggtacct gccgacgtgg
gcggtggaca aggttgtgct gctcatgtgc gccgtcgtgt tcggcggcga caccgcgcgg tacgggctcc ggcggccggc
cgtcgggccg ttctccatga AGATGACCAC GCCGGCGTAC CCGGTGTTCG ACGTCGGCAC CTTCGCCAAG ATCAGGTCCG
GGGAGATCCG CGTCGTGCCG GCCGGCATCA AGAGCGTCCG CGGcggcgac gtcgagttcg ccgacggccg gcgccacgcc
ttcgacgcca tcGTCTTCGC CACCGGTTAC CGGAGCACCA CCAAGCAGTG GCTCAAGGTA ATTAATTAAG TAAATTAATT
GAACACTGTG TGCATGAACT GGTTGTGTGC ATCATGATTC GTGCCGCGAC ACAAAGTCAT TTGGCGGGAA AGCTTTGCGA
AGAATAAAAA CTCCAACCGG TCTCAACTTT TGGGAGCACA CCCAGTACAC TTCATGTTCA GGGTACTGTG TGTTCCGAGA
ATATACCGGA AAATCGGaaa tagagtgtgg taaacaaccc cttcttaatt cttgatggga tatgttctcg tttgttccaa
tgccatccag attgttataa aaaaatttca acaaaaataa aaacccatgc aacaaacata ctccatccgt ctctaaatat
aagagatttt ggtccagatt catggtagta ggatacgtcc catccaccta aaatctctta tgttttggga cggagaaagt
aTACTGTTCC ACAAATTCTA AATTACTGCA AACTGGACAT ACGCATAAAA AGGTTTTCAA AAGAGACAAA TATAGTGTAT
GAAAAATATt actccctccg ttttttaata gataacaccg ttgacttttt ctcacatatt tgaccattcg tcttattcaa
aaattttatg taaatgtata agatataaat cacacttaaa gtactatgag tgataaaata actcataaca aaataaatta
taattacgta atctttttaa ataagacgaa tggtcaaaca tgtaagaaaa aatcaacggc gtcatctatt aaaaaacgga
ggtagtaGTA TTATTCACAT CCAATTTATA TTTTTTTTCT CAGTGTATGA TCGATTTTGA ACTTGATTTC AGCGAAGTTC
TATAAATAAT ACTTAGATGC TCTATATATT TTTACATGTC TTTTGTGAAT GGATTGTAGA GCGATGACGG GCTGATCGGC
GACGACGGGA TGGCGGGGCG GAGCTACCCG GATCACTGGA AGGGGGAGAA CGGGCTGTAC TGCGCCGGGA TGGTGAGGAG
GGGAATCTAC GGCAGCGGCG AGGACGCGGA GCTCATCGCC GACGACATCA GCAAGCAGAT GAAGCGCTGG AGCAGCGAGC
CCGTCTACAA TGGCCACATC AGCAACGGAT CCCCCTAA

Locus: Os01g0274100

Loading...

Locus: Os01g0274100

Loading...