Os01t0282800-02

Locus

Os01g0282800

Description

Similar to Tubulin beta-5 chain (Beta-5 tubulin).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

TUB1

CGSNL Gene Name

BETA-TUBULIN 1

Oryzabase Gene Symbol Synonym(s)

OsTUB1, TUBB1, OSTB-34

Oryzabase Gene Name Synonym(s)

beta tubulin 1, Tubulin beta-1 chain, Beta-1-tubulin

Transcript Evidence

AK122127 (DDBJ, Best hit)

AK065323 (DDBJ, Best hit)

Protein Evidence

NP_001105458.1 (RefSeq)

Literature

Note

Manual Curation

Full-length cDNA

J033132F08 (Online Clone Ordering)

J013002P20 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0282800-02)

RiceXPro (AK122127)

Others

Oryzabase (2956)

KEGG (Os01t0282800-02)

Transcript

1770 bp

>Os01t0282800-02 Similar to Tubulin beta-5 chain (Beta-5 tubulin).
GTGTTCCCCCATTTGCACACCCACCCCCCCCTTCACTCCTCTCCTCTTCGGCCGCTGCCC
CGCTACTCGCTTCTCCGAGGCACCAACCGGCAGCCATGAGGGAGATCCTGCACATCCAGG
GCGGGCAGTGTGGCAACCAGATCGGCTCCAAGTTCTGGGAGGTGGTCTGCGACGAGCACG
GCATCGACCCCACCGGCCGCTACGTCGGCACCTCCGACCTCCAGCTCGAGCGCGTCAACG
TCTACTACAATGAGGCCTCCTGCGGCCGCTTCGTGCCCCGCGCCGTGCTCATGGACCTCG
AGCCGGGTACCATGGACAGCGTCCGCACCGGCCCCTATGGCCAGATCTTCCGCCCCGACA
ACTTCGTCTTCGGCCAGTCCGGCGCCGGCAACAACTGGGCCAAGGGGCACTACACCGAGG
GCGCGGAGCTCATCGACTCTGTGCTCGATGTCGTCAGGAAGGAGGCTGAGAACTGCGACT
GCCTCCAAGGTTTCCAAGTTTGCCATTCCCTTGGAGGAGGCACTGGATCTGGAATGGGCA
CACTCCTGATCTCCAAGATCAGAGAGGAGTACCCTGACCGGATGATGCTCACATTTTCTG
TCTTCCCTTCACCAAAGGTCTCAGACACAGTTGTTGAGCCTTACAATGCAACTCTCTCTG
TCCATCAGTTGGTGGAGAATGCTGATGAGTGCATGGTTCTTGACAATGAGGCACTTTATG
ACATCTGCTTCCGCACCCTCAAGCTGACCACTCCTAGCTTTGGCGACCTGAACCACTTGA
TCAGTGCTACAATGAGTGGAGTTACTTGCTGCCTTCGCTTCCCTGGTCAATTGAACTCTG
ACCTCCGCAAGCTGGCCGTGAACTTGATCCCTTTCCCTCGCCTGCACTTCTTCATGGTGG
GCTTTGCGCCACTCACCTCGCGTGGCTCGCAGCAGTATCGCGCCCTCACTGTCCCTGAGC
TCACCCAGCAAATgtgggacgccaagaacatgatgtgtgccgctgacccgcgccatggcc
gctacctcacggcctccgccatgttccgtggcaagatgagcaccaaggaggtggacgagc
agatgatcaacgtccagaacaagaaCTCGTCCTACTTCGTCGAGTGGATCCCCAACAACG
TGAAGTCCAGCGTGTGCGACATCCCGCCGCGCGGCCTCTCCATGGCGTCCACCTTCATCG
GCAACTCCACCTCCATCCAGGAGATGTTCCGCCGCGTGAGCGAGCAGTTCACCGCCATGT
TCAGGAGGAAGGCCTTCTTGCATTGGTACACCGGCGAGGGCATGGACGAGATGGAGTTCA
CCGAGGCCGAGAGCAACATGAACGACCTTGTCTCCGAGTACCAGCAGTACCAGGATGCCA
CCGCCGACGAGGAGGGCGACTACGAGGACGAAGAGGAGCAGGTCCCCGAAGACGAGTAAT
CTCGCCGGAGTTTCTCCTGGGATCCCATCTTGAGTGTCGCCTGTTGTGTCCTACCGTTTG
GGCAATCTTTATTATTGTTTCGGTATGATGATGCTTAATTGGTTATGTGCTTTTGGGTAA
TGTAGTAGTAGTACAATGCTGTGTGGTCCGTAGCGCCGCTGATGCTACTGCCACTTTAAT
CCGTTTCACCTACCAGACCATGTTTGGATTCGTATGCTATCGCATATGTTTGGGGAGTGT
ATTGGATTCTTGTACTGGTTTTGATTGCTCCCGTTGCTGTCTCTTGTCTTGCTGCATCGA
TGAGAATCTTGCTGCTGCTTTGTTGCTGTC

CDS

1344 bp

>Os01t0282800-02 Similar to Tubulin beta-5 chain (Beta-5 tubulin).
ATGAGGGAGATCCTGCACATCCAGGGCGGGCAGTGTGGCAACCAGATCGGCTCCAAGTTC
TGGGAGGTGGTCTGCGACGAGCACGGCATCGACCCCACCGGCCGCTACGTCGGCACCTCC
GACCTCCAGCTCGAGCGCGTCAACGTCTACTACAATGAGGCCTCCTGCGGCCGCTTCGTG
CCCCGCGCCGTGCTCATGGACCTCGAGCCGGGTACCATGGACAGCGTCCGCACCGGCCCC
TATGGCCAGATCTTCCGCCCCGACAACTTCGTCTTCGGCCAGTCCGGCGCCGGCAACAAC
TGGGCCAAGGGGCACTACACCGAGGGCGCGGAGCTCATCGACTCTGTGCTCGATGTCGTC
AGGAAGGAGGCTGAGAACTGCGACTGCCTCCAAGGTTTCCAAGTTTGCCATTCCCTTGGA
GGAGGCACTGGATCTGGAATGGGCACACTCCTGATCTCCAAGATCAGAGAGGAGTACCCT
GACCGGATGATGCTCACATTTTCTGTCTTCCCTTCACCAAAGGTCTCAGACACAGTTGTT
GAGCCTTACAATGCAACTCTCTCTGTCCATCAGTTGGTGGAGAATGCTGATGAGTGCATG
GTTCTTGACAATGAGGCACTTTATGACATCTGCTTCCGCACCCTCAAGCTGACCACTCCT
AGCTTTGGCGACCTGAACCACTTGATCAGTGCTACAATGAGTGGAGTTACTTGCTGCCTT
CGCTTCCCTGGTCAATTGAACTCTGACCTCCGCAAGCTGGCCGTGAACTTGATCCCTTTC
CCTCGCCTGCACTTCTTCATGGTGGGCTTTGCGCCACTCACCTCGCGTGGCTCGCAGCAG
TATCGCGCCCTCACTGTCCCTGAGCTCACCCAGCAAATgtgggacgccaagaacatgatg
tgtgccgctgacccgcgccatggccgctacctcacggcctccgccatgttccgtggcaag
atgagcaccaaggaggtggacgagcagatgatcaacgtccagaacaagaaCTCGTCCTAC
TTCGTCGAGTGGATCCCCAACAACGTGAAGTCCAGCGTGTGCGACATCCCGCCGCGCGGC
CTCTCCATGGCGTCCACCTTCATCGGCAACTCCACCTCCATCCAGGAGATGTTCCGCCGC
GTGAGCGAGCAGTTCACCGCCATGTTCAGGAGGAAGGCCTTCTTGCATTGGTACACCGGC
GAGGGCATGGACGAGATGGAGTTCACCGAGGCCGAGAGCAACATGAACGACCTTGTCTCC
GAGTACCAGCAGTACCAGGATGCCACCGCCGACGAGGAGGGCGACTACGAGGACGAAGAG
GAGCAGGTCCCCGAAGACGAGTAA

Protein

448 aa

>Os01t0282800-02 Similar to Tubulin beta-5 chain (Beta-5 tubulin).
MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV
PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
RKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLTFSVFPSPKVSDTVV
EPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLNHLISATMSGVTCCL
RFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTVPELTQQMWDAKNMM
CAADPRHGRYLTASAMFRGKMSTKEVDEQMINVQNKNSSYFVEWIPNNVKSSVCDIPPRG
LSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATADEEGDYEDEEEQVPEDE*

5'UTR

chr01:10102870..10102948 (- strand) : 79 bp

chr01:10102274..10102289 (- strand) : 16 bp

CDS

chr01:10101880..10102273 (- strand) : 394 bp

chr01:10100897..10101166 (- strand) : 270 bp

chr01:10099683..10100362 (- strand) : 680 bp

3'UTR

chr01:10099352..10099682 (- strand) : 331 bp

FASTA

>Os01t0282800-02 class=Sequence position=chr01:10099352..10102948 (- strand)
GTGTTCCCCC ATTTGCACAC CCACCCCCCC CTTCACTCCT CTCCTCTTCG GCCGCTGCCC CGCTACTCGC TTCTCCGAGG
TAATTACGAC GGGATTTTGC TATCGTTTTG GTTGCCGGAC CTGGGATTGT GTGGGGTTTT GGATCTGGTT CGTGGTTTTG
CGGTGGATTT GGTTGGGGTC GTGGTGGATT TGAGGGATTT TTTGTTTTGA GGTTTCGTTT GCTCGTTCTG TGAGTATTCT
TTTTGGGCGA GGTTGCGGAT TTGTGAGGTG TTTTTAGGTT CTCACAGCAG GAGTTCGGGC TTTCTTTATG TTAGATCTGT
TTTTTTGGTA GATTTTTAGT TGTTTTGCAG TCCACTCGGC TTATTTCGGA AGGTTTTATC TGTGACATTT TGGGATTTGC
TTCTCGGATT TGCTCTCATC GAACGTGCTT TCACTGAGAA CATATACTAG ATTCGTTTCG GTTCCCGTTT TGCTGCCTTT
TTGTTCAAAT TTTGAGCTTG GATCTGTGTC CTGTTTTGAA CTTTTTGCTC TCAAAATACC GGGGGATTTG AGCTTTTCAA
AAGCAGATCT GGTCCTCCTT CCATTTCAAA CCAATCCCCC ATCGTTTTCT CGCACCTAAC CGCGGAATCT CCTTCGATTT
GCCTCCCTCC CACCCGCAGG CACCAACCGG CAGCCATGAG GGAGATCCTG CACATCCAGG GCGGGCAGTG TGGCAACCAG
ATCGGCTCCA AGTTCTGGGA GGTGGTCTGC GACGAGCACG GCATCGACCC CACCGGCCGC TACGTCGGCA CCTCCGACCT
CCAGCTCGAG CGCGTCAACG TCTACTACAA TGAGGCCTCC TGCGGCCGCT TCGTGCCCCG CGCCGTGCTC ATGGACCTCG
AGCCGGGTAC CATGGACAGC GTCCGCACCG GCCCCTATGG CCAGATCTTC CGCCCCGACA ACTTCGTCTT CGGCCAGTCC
GGCGCCGGCA ACAACTGGGC CAAGGGGCAC TACACCGAGG GCGCGGAGCT CATCGACTCT GTGCTCGATG TCGTCAGGAA
GGAGGCTGAG AACTGCGACT GCCTCCAAGG TCGATTCCTT GCTCCACTGT TAAAATGTTG CTTGTTAATT ATGTTCGCGT
GATTCCCGTG ATGCGTGTTA GTTCAGATCT GGGTGAAAAT AGTTCCAGAT TTGGTAGTGT CGGCTGCTTT TTTTTCTTTT
CTTTTATAAG CATATAATTT ATCATGTGAT GCTTTAGCTT TTTAGTAGAG TATTTTATTT CCTGTAGTAG CTTTTTGTTA
GCTAGTACGT GTCACCCTGA TATAATGGAA CTTTAATAAT CTATAATGTA GATTCCAAAG TGCTAATTAT TTAGTCTTTG
CTAAACTTGT TGTGCGGTAT TATTGACCAT TGTGATTTAC CCACCTTGTG CTGTTTACAG CGAGTGAGGT CTTTACTCTT
GGTTTAGTGT TTGGTTTCTA ATAAGACTAC TTGTTGCTCC AGTGTAATTT TGTTGTCATG TAACATAAGT GCGGATAGTT
TTAAGCTGGC AAACTTGATT GTTGTGGTTA CAGTTTTTTA TGTTTAAAGC TCTGTTCAAA TGATTTAGCC TGGGATTGTT
TTATTGTTGT CAGTCTCTTA TTAAGCTGTA AATCTTATTG CTAGCTTGTT ATTCTGAAAT ATGGAGTAGT TTTTAATCCT
TGCCATAAAA CCCTACCATG AAATCTATTT CAGCAATCCT ATGGCTATTA TGTTAGCTAG CACTGCATCA CCTTATATAT
GTTTTGTCTT TTCTGTAATC AGGTTTCCAA GTTTGCCATT CCCTTGGAGG AGGCACTGGA TCTGGAATGG GCACACTCCT
GATCTCCAAG ATCAGAGAGG AGTACCCTGA CCGGATGATG CTCACATTTT CTGTCTTCCC TTCACCAAAG GTCTCAGACA
CAGTTGTTGA GCCTTACAAT GCAACTCTCT CTGTCCATCA GTTGGTGGAG AATGCTGATG AGTGCATGGT TCTTGACAAT
GAGGCACTTT ATGACATCTG CTTCCGCACC CTCAAGCTGA CCACTCCTAG CTGTAAGTTA ATTCTTACTC TGGTTCTAAC
TAGTGGCATA TGCTGTTCAG ATTTTCAGAG ATGTATTTGG TAGCTTAGTT TCATTCCAAT GTCAATGCTT GCTTTGGTAG
ATCCATGTAT CTTGTGTGGA TCTTGCTATC CATTATTTGC AGTCCAATTT GCATGGTCCC AAGCCCAGCA TGATCTACCT
TGCCTTGTTT AATTATGAGG CCAGTTACAT CTGAATCCCC TTGCTGGTTC GGTGGTTTAA TTTATTTGCA CCCATCGTAC
AGATCAAGCA TGTTTCCTGT ACACATTATT GCATCATAAT TCAGTAGCTG GCATGATAGT GCCACCTACT CCTACATAAG
GGCATCAACT TTTCTTAGGA ATGTTGTTGA GTGCATCATG TACTACTATC TTTATTTAAC CATAATTATT TTTGATTCAT
GTTAAAAACT TGCATCTAGT TTCTGTCTGT ACTACAGTCT CTGCCTGTAA AGTTGCTATA GTGTTTTTAT CCTAGTTTGG
CTAACCTAAA TTTTTCATAT GAACAGTTGG CGACCTGAAC CACTTGATCA GTGCTACAAT GAGTGGAGTT ACTTGCTGCC
TTCGCTTCCC TGGTCAATTG AACTCTGACC TCCGCAAGCT GGCCGTGAAC TTGATCCCTT TCCCTCGCCT GCACTTCTTC
ATGGTGGGCT TTGCGCCACT CACCTCGCGT GGCTCGCAGC AGTATCGCGC CCTCACTGTC CCTGAGCTCA CCCAGCAAAT
gtgggacgcc aagaacatga tgtgtgccgc tgacccgcgc catggccgct acctcacggc ctccgccatg ttccgtggca
agatgagcac caaggaggtg gacgagcaga tgatcaacgt ccagaacaag aaCTCGTCCT ACTTCGTCGA GTGGATCCCC
AACAACGTGA AGTCCAGCGT GTGCGACATC CCGCCGCGCG GCCTCTCCAT GGCGTCCACC TTCATCGGCA ACTCCACCTC
CATCCAGGAG ATGTTCCGCC GCGTGAGCGA GCAGTTCACC GCCATGTTCA GGAGGAAGGC CTTCTTGCAT TGGTACACCG
GCGAGGGCAT GGACGAGATG GAGTTCACCG AGGCCGAGAG CAACATGAAC GACCTTGTCT CCGAGTACCA GCAGTACCAG
GATGCCACCG CCGACGAGGA GGGCGACTAC GAGGACGAAG AGGAGCAGGT CCCCGAAGAC GAGTAATCTC GCCGGAGTTT
CTCCTGGGAT CCCATCTTGA GTGTCGCCTG TTGTGTCCTA CCGTTTGGGC AATCTTTATT ATTGTTTCGG TATGATGATG
CTTAATTGGT TATGTGCTTT TGGGTAATGT AGTAGTAGTA CAATGCTGTG TGGTCCGTAG CGCCGCTGAT GCTACTGCCA
CTTTAATCCG TTTCACCTAC CAGACCATGT TTGGATTCGT ATGCTATCGC ATATGTTTGG GGAGTGTATT GGATTCTTGT
ACTGGTTTTG ATTGCTCCCG TTGCTGTCTC TTGTCTTGCT GCATCGATGA GAATCTTGCT GCTGCTTTGT TGCTGTC

Locus: Os01g0282800

Loading...

Locus: Os01g0282800

Loading...