Os01t0284700-01

Locus

Os01g0284700

Description

Similar to Peptidyl-prolyl cis-trans isomerase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CYP20-3

CGSNL Gene Name

CYCLOPHILIN 20-3

Oryzabase Gene Symbol Synonym(s)

OsCYP20-3, OsCYP-5

Oryzabase Gene Name Synonym(s)

cyclophilin 20-3, cyclophilin 5

Transcript Evidence

AK243124 (DDBJ, Best hit)

Protein Evidence

B8ACM2 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein folding (GO:0006457)

Molecular Function: peptidyl-prolyl cis-trans isomerase activity (GO:0003755)

Functional domain (InterPro)

Peptidyl-prolyl cis-trans isomerase, cyclophilin-type (IPR002130)

Cyclophilin-like (IPR015891)

Peptidyl-prolyl cis-trans isomerase, cyclophilin-type, conserved site (IPR020892)

Full-length cDNA

J100029E10 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0284700-01)

Others

Oryzabase (10061)

KEGG (Os01t0284700-01 (EC:5.2.1.8))

Transcript

1257 bp

>Os01t0284700-01 Similar to Peptidyl-prolyl cis-trans isomerase.
GAATCGAATCCGATAAGCCAAGCAAGCGCAGACGCCGACGCAGGAGCTCCCCCACCGCCA
TGGCTTGCAGGCCGGCCGTGTGCTCCCCCTCCGCCCTCGCGCCGCCGCGCCACCGCCTCC
TCTCCCTCGGCTGCGCGCGCACCGCCGCCCCCTCGGGCGGACTCCCGCTCCGCCTCCGCC
TCCGCTCCAGCCCCGCGCCCCGCGGCCACGGCGCCGACCTCGTCGTCCGCGCGGCGGCCG
CAGAGGGGGCCGTGGAGCTGCAGGCGAAGGTGAACAGCAAATGCTTCTTCGACGTCGAGG
TCGGCGGGGAGCCCGCGGGGAGGATCGTCATCGGGCTCTTCGGGGAAGTCGTCCCCAAGA
CGGTGGACAACTTCCGCGCCCTGTGCACTGGTGATAAGGGCTACGGGTACAAGGGTTGCT
CCTTCCACCGAATCATCAAGGACTTCATGATTCAGGGCGGGGACTTCCAGAACAACAATG
GTACTGGTGGTAGGAGTATCTATGGTGAATGTTTTGACGATGAAAATTTTACATGTAAGT
AATTCAATCCTAGCTTGCTGTGATGAGCTTGGGGTGTTCTTTCCCCCTAGCAGTTGACTG
CAACTGCTTTAGGCAGTCACAACAACCCTGTTGTTATGTACTCGAACCTTTCTCCCATAT
CTTAATAAAATCAGGCGGCATCCTTCCACCAGCCCAGCGAAAAAAAATACAAACTTTCAA
ATTTAGTACCATGCGTTATTGTAACTATCCAGAACATACCAATCAATTGAAGCAACGATA
ACTACAAAGGTGCTAATCTTTAGTAAAGCACACCGGTCCTGGTGTACTAAGCATGGCAAA
CGCTGGCCCTGACACAAATGGAAGCCAATTTTTCATTTGTACTGTGAAGACACCATGGTT
GGACAATCGTCACGTTGTCTTTGGGCATGTCTTGGAGGGGATGGACGTGGTGAAGAATCT
TGAATCACAAGAAACCAGCAGGTCCGATATTCCTAAGCAGCCCTGCAGAATCGTGAATTG
TGGCGAGCTGCCCGTGGACGGTTGATTAAGTCAAATGGTTCAGTTGTCGGATTAAGCCAA
CATTTTTCATTTTGTTCTGCGGCATATTGAATCTTAGGGGAGGGCTAATTGAATCTTGTT
CTGTTAGAACACTTTTGGTATAGTGAGGATACTTGCGAGGCATTCGGCAAGATAGATGAA
CATCCCTCTTATCCAGTGATATCCTGTTTGATGAGCTTAGAACTTTAAGTTACTCTT

CDS

483 bp

>Os01t0284700-01 Similar to Peptidyl-prolyl cis-trans isomerase.
ATGGCTTGCAGGCCGGCCGTGTGCTCCCCCTCCGCCCTCGCGCCGCCGCGCCACCGCCTC
CTCTCCCTCGGCTGCGCGCGCACCGCCGCCCCCTCGGGCGGACTCCCGCTCCGCCTCCGC
CTCCGCTCCAGCCCCGCGCCCCGCGGCCACGGCGCCGACCTCGTCGTCCGCGCGGCGGCC
GCAGAGGGGGCCGTGGAGCTGCAGGCGAAGGTGAACAGCAAATGCTTCTTCGACGTCGAG
GTCGGCGGGGAGCCCGCGGGGAGGATCGTCATCGGGCTCTTCGGGGAAGTCGTCCCCAAG
ACGGTGGACAACTTCCGCGCCCTGTGCACTGGTGATAAGGGCTACGGGTACAAGGGTTGC
TCCTTCCACCGAATCATCAAGGACTTCATGATTCAGGGCGGGGACTTCCAGAACAACAAT
GGTACTGGTGGTAGGAGTATCTATGGTGAATGTTTTGACGATGAAAATTTTACATGTAAG
TAA

Protein

161 aa

>Os01t0284700-01 Similar to Peptidyl-prolyl cis-trans isomerase.
MACRPAVCSPSALAPPRHRLLSLGCARTAAPSGGLPLRLRLRSSPAPRGHGADLVVRAAA
AEGAVELQAKVNSKCFFDVEVGGEPAGRIVIGLFGEVVPKTVDNFRALCTGDKGYGYKGC
SFHRIIKDFMIQGGDFQNNNGTGGRSIYGECFDDENFTCK*

5'UTR

chr01:10193658..10193716 (+ strand) : 59 bp

CDS

chr01:10193717..10193900 (+ strand) : 184 bp

chr01:10194007..10194153 (+ strand) : 147 bp

chr01:10194255..10194343 (+ strand) : 89 bp

chr01:10194933..10194995 (+ strand) : 63 bp

3'UTR

chr01:10194996..10195256 (+ strand) : 261 bp

chr01:10195531..10195616 (+ strand) : 86 bp

chr01:10196244..10196611 (+ strand) : 368 bp

FASTA

>Os01t0284700-01 class=Sequence position=chr01:10193658..10196611 (+ strand)
GAATCGAATC CGATAAGCCA AGCAAGCGCA GACGCCGACG CAGGAGCTCC CCCACCGCCA TGGCTTGCAG GCCGGCCGTG
TGCTCCCCCT CCGCCCTCGC GCCGCCGCGC CACCGCCTCC TCTCCCTCGG CTGCGCGCGC ACCGCCGCCC CCTCGGGCGG
ACTCCCGCTC CGCCTCCGCC TCCGCTCCAG CCCCGCGCCC CGCGGCCACG GCGCCGACCT CGTCGTCCGC GCGGCGGCCG
CAGAGGCAAG CCCTCTCTTC CCCCACCACC ACCCGCGGCT CACCGACCCT TGGCCTGGCC GGCGTGCTGA GCTTCATCAG
TAATCGAATT TTGTCTGTCT GTCTGCTGCA GGGGGCCGTG GAGCTGCAGG CGAAGGTGAA CAGCAAATGC TTCTTCGACG
TCGAGGTCGG CGGGGAGCCC GCGGGGAGGA TCGTCATCGG GCTCTTCGGG GAAGTCGTCC CCAAGACGGT GGACAACTTC
CGCGCCCTGT GCACTGGTCG GCTCGGCCCC CCCTCGTTGA TAATCTGATC TCCATTTCGC CATCAAAATT GCCAGATTGG
TAGTAACGCT TATTTTCTGT TTTACTTGAT TTTGCAGGTG ATAAGGGCTA CGGGTACAAG GGTTGCTCCT TCCACCGAAT
CATCAAGGAC TTCATGATTC AGGGCGGGGA CTTCCAGAAC AACAATGTGA GAGTTGCACA TCCAAATGCA GATGCTGTAA
TGGCTATTGT ACTAGTTTCT GCTGCTGAAT TGAGGACTTA TCTGTCCCAT TTCATTCAAC CACTGCACTG TGTGTGCAAA
TTAATTTGGG GGGTGAACAA TATGACTGGT CCTGAATTGA GCTAGTTATC TTCATTTAGC ATTGCTGCAT GCCTGCATTG
GTCCATCCCC TTGCACTACT GCATTACTGC TGCACGGTAT GTGCAAATTA ATTTGAGAGT AGGATGCAGT GTGCACAAAA
ATGTTCAGAT TCAGATTGGA GAAAGGGGTA GGAAAGGATA CCATAAATGA CGAGCAAAGT GTACTCAACT TTGGAGTTAA
GATGGGCGCA TAGGCAGATA GCTGTTAGAT ATAGGTGTAG ATTTATATGT ATATTTGTAT ATATTGGAAA AAGGACCTAA
TAGCCCCATA GCTCATTTAC CTACTGCTGA TATATTCTTT CTTATGTTGC CAATCTTATT TACAGTGTTT ATGAACATTT
CTTCTTTCTC TGTTTTGCAT GCTAAAGGGT CGCCCTTTTT TTTTATTGCT GATGTACTAA GCTTTTGTAA CACAGGGTAC
TGGTGGTAGG AGTATCTATG GTGAATGTTT TGACGATGAA AATTTTACAT GTAAGTAATT CAATCCTAGC TTGCTGTGAT
GAGCTTGGGG TGTTCTTTCC CCCTAGCAGT TGACTGCAAC TGCTTTAGGC AGTCACAACA ACCCTGTTGT TATGTACTCG
AACCTTTCTC CCATATCTTA ATAAAATCAG GCGGCATCCT TCCACCAGCC CAGCGAAAAA AAATACAAAC TTTCAAATTT
AGTACCATGC GTTATTGTAA CTATCCAGAA CATACCAATC AATTGAAGCA ACGATAACTA CAAAGGTGCT AATCTTTAGG
TAAATTTCCT CATTTTGTCA CTGGTTTTTG CAATCATGAT GACATGAGAA AAATACTTTG GTTAATTTCC AGCATGCATG
ATCCTCAAGC ATATTGTTTA CACGAAGTCA TGGATAGTAA AAGGTGCTCC GTGGAACAAA ATAATGGCAC ATATGATTCT
AAACTCTGAA GTGTCATAAT TTGTCAAGTA TAGGTTCCAG TCTAGTAGTT CCTACAATGA AGCCCTTCTT TATCTTATAC
ATATCATAAT CCATCTTTTG TATCCTTTTT CAGTAAAGCA CACCGGTCCT GGTGTACTAA GCATGGCAAA CGCTGGCCCT
GACACAAATG GAAGCCAATT TTTCATTTGT ACTGTGAAGG TAAGAAACTC CTGATAGTAT AAAGCAACTT TTTTTCATTC
ACGATTTTAC TACTGGACAG GGCAATAGGG CATCCTAAAT TTGTAACACT GACAAATTAT AGTCTCGTTC TCATGCACAT
CTAAAATGGC AGTAATTCTA AGTTTATTTT GCCTTACAAT ATGAACGAAT ATTTATGGGC TAGTTCATGC TGGTAGTGTT
GAGATCATAG GATTGATAAA AGGATCACTG TAAGATCTGG ACCATTAATG GTTTGGCAAG AGCGTATGAT CGTAAAATAC
TACAGTATGA GTCATGATAT GGACAACTTT AGTTCAGTCA CTTCAAAGAA CTAAATCAGG TGTTGAACCG GTATAAGTCC
TTAAAGCAAT GATAGATTCC TAGCCCTAGA CTAAAACTCA AATCCTTGGT GGCAAAAGGT CTAACACTAA TGAATGGCTG
CTGGTACTTG ACTCCATCTC TCTTAAAATG TTATTTGTCT TACTAATCTA AACAGCCTTG AGTATTCCAA TTTTGAGGAA
GAGAAAAATG TGCAAAAATT TTCGACATTA GTTCTGTTTA GACTTTGTTA GATTTCTTTA CAGTTGATGG GTCTAACCAA
ACTCTCAATA ATAAAATCTT TCTCAGACAC CATGGTTGGA CAATCGTCAC GTTGTCTTTG GGCATGTCTT GGAGGGGATG
GACGTGGTGA AGAATCTTGA ATCACAAGAA ACCAGCAGGT CCGATATTCC TAAGCAGCCC TGCAGAATCG TGAATTGTGG
CGAGCTGCCC GTGGACGGTT GATTAAGTCA AATGGTTCAG TTGTCGGATT AAGCCAACAT TTTTCATTTT GTTCTGCGGC
ATATTGAATC TTAGGGGAGG GCTAATTGAA TCTTGTTCTG TTAGAACACT TTTGGTATAG TGAGGATACT TGCGAGGCAT
TCGGCAAGAT AGATGAACAT CCCTCTTATC CAGTGATATC CTGTTTGATG AGCTTAGAAC TTTAAGTTAC TCTT

Locus: Os01g0284700

Loading...

Locus: Os01g0284700

Loading...