Os01t0285300-01

Locus

Os01g0285300

Description

MYB transcription factor, Regulation of cellulose synthesis, Promotion of nitrogen utilization and biomass production, Secondary cell wall formation

RAP-DB Gene Symbol Synonym(s)

MYB61, OsMYB55/61

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsMYB55/61, OsMYB55, MYB55, OsMYB61, MYB61, OsMYB61a, MYB61a

Oryzabase Gene Name Synonym(s)

myb transcription factor 55/61, transcription factor MYB55/61

Transcript Evidence

AK111803

Protein Evidence

Q9AQV2

Literature

PMID: 33060584

PMID: 24089432

PMID: 26002868

Note

Manual Curation

October 20, 2020

Gene Ontology (GO)

Molecular Function: DNA binding (GO:0003677)

Functional domain (InterPro)

Homeobox-like domain superfamily (IPR009057)

SANT/Myb domain (IPR001005)

Myb domain (IPR017930)

Experimentally confirmed subcellular location

nucleus (GO:0005634)

Full-length cDNA

J013087D08 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0285300-01)

RiceXPro (AK111803)

Others

Oryzabase (15017)

KEGG (Os01t0285300-01)

Transcript

1695 bp

>Os01t0285300-01 MYB transcription factor, Regulation of cellulose synthesis, Promotion of nitrogen utilization and biomass production, Secondary cell wall formation
GCAAAGAAAAGGAGAAGAGTGCCCTCTAACCTACCTATGCCTTCCTCCAAAATCCTGATA
TCTTGAGCCACTTGTTGCTGCCACTCTGCCATAAGCTTCCATCCTATCAAGCACCAATAT
ATGAGCCACTATAGACTGTACACTCGCAGCAATCCCACTCTTGAGCACTGAATCACCAAG
AGGATTACCTGTGTAGGTGTTGTGTGCTGTGGAAGTTTCTTGGGAGGGCAAGCTGTGCAG
ATTGCATAGCTTCAGTTTCTGCATTGATTCAATGGGGAGACATTCCTGCTGCTACAAGCA
GAAGCTGAGGAAGGGGCTCTGGTCACCTGAGGAGGATGAGAAGCTCATGAACCACATAAC
CAAGCATGGCCATGGCTGCTGGAGCACCGTTCCAAAACTTGCAGGGCTTCAGAGATGTGG
CAAAAGCTGCAGGCTGAGATGGATAAACTACTTGAGGCCTGACCTAAAGAGAGGTGCATT
CTCTCAGGAGGAAGAGGACCTCATCGTTGAGCTCCATGCTGTTCTGGGAAACAGgtggtc
tcaaattgcaacacggctgcctggaagaactgacaatgagatcaagaatctctggaattc
atgcatcaagaagaagctgcggcagaaaggcattgacccaaacacccacaagccccttgc
cgaggttgatcgaagcaaagcaactcccaccatcagcaatgacaggacctctgaatccag
cgatgttgacccatctagtggcgttgctcttcacaacttgagccatcttctgagcgagac
ggcgcaatcatcagagctgctgccagtgaaggtaactaaacctcgcacacaagctccggg
cttggcacgtctgaaggtgcCACCGAAGGAACTATTTCTAGACCAGCTTACTTCTGGCCA
TGAGAACCTCCCTAGCTGCCGTTCATCTGGCCCAATTCCCAATTTCCCGTTCCAGCAGCT
GTTGTGCTACAATAATGATTTTAACAGCATGGACGTTGGAAACAGGAATTCACTCTGGTA
TAACCAGAATGAGTCCAGTAGCAGCACAATTTCCACTGTGATGCCCCCAGTTTCACCATC
AACTCTCTCGACATCAACAGGCCTTAATCCATCACCAGACAATGCAAACTCTCGAGGCAC
TGGCATCCACAATTCCCAATTCTATTGGGACACCAACAATCCTAGCAGCAGTAGCAGTAC
AGGGAGTAGTGGTAACAACGGGTTGGGATTCGAGCTGCAAAGCACAAGCTCCCTTTTGGA
GACCAACATATTCCCATGGTCAGATTTAGCACCAGAAAAGGATAGCCAAGCACAACTAGA
GGAAGAACTCAAGTGGCCTGACTTGCTCCATGGAACGTTCTCAGAGATGCCAGCGCCCAT
GCAGAACCTTAGCCAGTCACTGTATGAAGACGTTGTCAAAGCAGAGAGCCAATTCAACAT
GGAGGGGCTCTGTGCAGCTTGGTCTCAAAACCTGCTGCCACAGCAACATCTTCCAGTAGT
ATCAGATATGTATGACAAGGATTTGCAAAGGATGTCCTTGTCTTTTGAGAATATCTAGGA
ACCATGTTCCAGCATGCAGGGAACAGAGCACCACATGAAAATTGAGAGTTGAAAGCTTAG
GAAGCACAATGTTTCTTCAGAGATACGTTTACAGTGTACTCAGTTGTTTGTGGATAAATT
ATTGTGAGTGTTCAC

CDS

1287 bp

>Os01t0285300-01 MYB transcription factor, Regulation of cellulose synthesis, Promotion of nitrogen utilization and biomass production, Secondary cell wall formation
ATGGGGAGACATTCCTGCTGCTACAAGCAGAAGCTGAGGAAGGGGCTCTGGTCACCTGAG
GAGGATGAGAAGCTCATGAACCACATAACCAAGCATGGCCATGGCTGCTGGAGCACCGTT
CCAAAACTTGCAGGGCTTCAGAGATGTGGCAAAAGCTGCAGGCTGAGATGGATAAACTAC
TTGAGGCCTGACCTAAAGAGAGGTGCATTCTCTCAGGAGGAAGAGGACCTCATCGTTGAG
CTCCATGCTGTTCTGGGAAACAGgtggtctcaaattgcaacacggctgcctggaagaact
gacaatgagatcaagaatctctggaattcatgcatcaagaagaagctgcggcagaaaggc
attgacccaaacacccacaagccccttgccgaggttgatcgaagcaaagcaactcccacc
atcagcaatgacaggacctctgaatccagcgatgttgacccatctagtggcgttgctctt
cacaacttgagccatcttctgagcgagacggcgcaatcatcagagctgctgccagtgaag
gtaactaaacctcgcacacaagctccgggcttggcacgtctgaaggtgcCACCGAAGGAA
CTATTTCTAGACCAGCTTACTTCTGGCCATGAGAACCTCCCTAGCTGCCGTTCATCTGGC
CCAATTCCCAATTTCCCGTTCCAGCAGCTGTTGTGCTACAATAATGATTTTAACAGCATG
GACGTTGGAAACAGGAATTCACTCTGGTATAACCAGAATGAGTCCAGTAGCAGCACAATT
TCCACTGTGATGCCCCCAGTTTCACCATCAACTCTCTCGACATCAACAGGCCTTAATCCA
TCACCAGACAATGCAAACTCTCGAGGCACTGGCATCCACAATTCCCAATTCTATTGGGAC
ACCAACAATCCTAGCAGCAGTAGCAGTACAGGGAGTAGTGGTAACAACGGGTTGGGATTC
GAGCTGCAAAGCACAAGCTCCCTTTTGGAGACCAACATATTCCCATGGTCAGATTTAGCA
CCAGAAAAGGATAGCCAAGCACAACTAGAGGAAGAACTCAAGTGGCCTGACTTGCTCCAT
GGAACGTTCTCAGAGATGCCAGCGCCCATGCAGAACCTTAGCCAGTCACTGTATGAAGAC
GTTGTCAAAGCAGAGAGCCAATTCAACATGGAGGGGCTCTGTGCAGCTTGGTCTCAAAAC
CTGCTGCCACAGCAACATCTTCCAGTAGTATCAGATATGTATGACAAGGATTTGCAAAGG
ATGTCCTTGTCTTTTGAGAATATCTAG

Protein

429 aa

>Os01t0285300-01 MYB transcription factor, Regulation of cellulose synthesis, Promotion of nitrogen utilization and biomass production, Secondary cell wall formation
MGRHSCCYKQKLRKGLWSPEEDEKLMNHITKHGHGCWSTVPKLAGLQRCGKSCRLRWINY
LRPDLKRGAFSQEEEDLIVELHAVLGNRWSQIATRLPGRTDNEIKNLWNSCIKKKLRQKG
IDPNTHKPLAEVDRSKATPTISNDRTSESSDVDPSSGVALHNLSHLLSETAQSSELLPVK
VTKPRTQAPGLARLKVPPKELFLDQLTSGHENLPSCRSSGPIPNFPFQQLLCYNNDFNSM
DVGNRNSLWYNQNESSSSTISTVMPPVSPSTLSTSTGLNPSPDNANSRGTGIHNSQFYWD
TNNPSSSSSTGSSGNNGLGFELQSTSSLLETNIFPWSDLAPEKDSQAQLEEELKWPDLLH
GTFSEMPAPMQNLSQSLYEDVVKAESQFNMEGLCAAWSQNLLPQQHLPVVSDMYDKDLQR
MSLSFENI*

5'UTR

chr01:10219421..10219691 (- strand) : 271 bp

CDS

chr01:10219288..10219420 (- strand) : 133 bp

chr01:10219044..10219173 (- strand) : 130 bp

chr01:10217919..10218942 (- strand) : 1024 bp

3'UTR

chr01:10217782..10217918 (- strand) : 137 bp

FASTA

>Os01t0285300-01 class=Sequence position=chr01:10217782..10219691 (- strand)
GCAAAGAAAA GGAGAAGAGT GCCCTCTAAC CTACCTATGC CTTCCTCCAA AATCCTGATA TCTTGAGCCA CTTGTTGCTG
CCACTCTGCC ATAAGCTTCC ATCCTATCAA GCACCAATAT ATGAGCCACT ATAGACTGTA CACTCGCAGC AATCCCACTC
TTGAGCACTG AATCACCAAG AGGATTACCT GTGTAGGTGT TGTGTGCTGT GGAAGTTTCT TGGGAGGGCA AGCTGTGCAG
ATTGCATAGC TTCAGTTTCT GCATTGATTC AATGGGGAGA CATTCCTGCT GCTACAAGCA GAAGCTGAGG AAGGGGCTCT
GGTCACCTGA GGAGGATGAG AAGCTCATGA ACCACATAAC CAAGCATGGC CATGGCTGCT GGAGCACCGT TCCAAAACTT
GCAGGTGAGC ATCAAAATAT TCTGCACTTT ATTCTTGTCG ATTATCCACT TTGTGTTCTT TCTTCTCAGT CAATTCAAGT
CTCCCCTGAA ATCTTAGCAA TCAAACGAAT TGTTGCAGGG CTTCAGAGAT GTGGCAAAAG CTGCAGGCTG AGATGGATAA
ACTACTTGAG GCCTGACCTA AAGAGAGGTG CATTCTCTCA GGAGGAAGAG GACCTCATCG TTGAGCTCCA TGCTGTTCTG
GGAAACAGGT AAATTTGAAC TCAATTGCAC TGCTAGAGTT TAGGATTTAA TTACCTCATC AAATCGAGCC TCCTCTAATT
ATGGCCTTTT TTTTcacatc aatgagcagg tggtctcaaa ttgcaacacg gctgcctgga agaactgaca atgagatcaa
gaatctctgg aattcatgca tcaagaagaa gctgcggcag aaaggcattg acccaaacac ccacaagccc cttgccgagg
ttgatcgaag caaagcaact cccaccatca gcaatgacag gacctctgaa tccagcgatg ttgacccatc tagtggcgtt
gctcttcaca acttgagcca tcttctgagc gagacggcgc aatcatcaga gctgctgcca gtgaaggtaa ctaaacctcg
cacacaagct ccgggcttgg cacgtctgaa ggtgcCACCG AAGGAACTAT TTCTAGACCA GCTTACTTCT GGCCATGAGA
ACCTCCCTAG CTGCCGTTCA TCTGGCCCAA TTCCCAATTT CCCGTTCCAG CAGCTGTTGT GCTACAATAA TGATTTTAAC
AGCATGGACG TTGGAAACAG GAATTCACTC TGGTATAACC AGAATGAGTC CAGTAGCAGC ACAATTTCCA CTGTGATGCC
CCCAGTTTCA CCATCAACTC TCTCGACATC AACAGGCCTT AATCCATCAC CAGACAATGC AAACTCTCGA GGCACTGGCA
TCCACAATTC CCAATTCTAT TGGGACACCA ACAATCCTAG CAGCAGTAGC AGTACAGGGA GTAGTGGTAA CAACGGGTTG
GGATTCGAGC TGCAAAGCAC AAGCTCCCTT TTGGAGACCA ACATATTCCC ATGGTCAGAT TTAGCACCAG AAAAGGATAG
CCAAGCACAA CTAGAGGAAG AACTCAAGTG GCCTGACTTG CTCCATGGAA CGTTCTCAGA GATGCCAGCG CCCATGCAGA
ACCTTAGCCA GTCACTGTAT GAAGACGTTG TCAAAGCAGA GAGCCAATTC AACATGGAGG GGCTCTGTGC AGCTTGGTCT
CAAAACCTGC TGCCACAGCA ACATCTTCCA GTAGTATCAG ATATGTATGA CAAGGATTTG CAAAGGATGT CCTTGTCTTT
TGAGAATATC TAGGAACCAT GTTCCAGCAT GCAGGGAACA GAGCACCACA TGAAAATTGA GAGTTGAAAG CTTAGGAAGC
ACAATGTTTC TTCAGAGATA CGTTTACAGT GTACTCAGTT GTTTGTGGAT AAATTATTGT GAGTGTTCAC 

Locus: Os01g0285300

Loading...

Locus: Os01g0285300

Loading...