Os01t0292700-01

Locus

Os01g0292700

Description

Intermediate filament, Cytoskeleton protein, Tolerance to salinity and heat stress

RAP-DB Gene Symbol Synonym(s)

OsIF, OsIFL

RAP-DB Gene Name Synonym(s)

Oryza sativa intermediate filament, intermediate filament like protein

CGSNL Gene Symbol

IF

CGSNL Gene Name

INTERMEDIATE FILAMENT

Oryzabase Gene Symbol Synonym(s)

OsIFL, IFL, OsIF

Oryzabase Gene Name Synonym(s)

intermediate filament like protein, intermediate filament

Transcript Evidence

Inferred from literature

Protein Evidence

Q5JNS1

Literature

PMID: 29511223

PMID: 27708383

Note

Manual Curation

March 12, 2018

Experimentally confirmed subcellular location

nucleus (GO:0005634)

cytoplasm (GO:0005737)

Expression Databases

TENOR (Os01t0292700-00)

Others

Oryzabase (21441)

Transcript

1027 bp

>Os01t0292700-01 Intermediate filament, Cytoskeleton protein, Tolerance to salinity and heat stress
ATGCCGATTTCAGAGAGGGCAACAACAACGCCATCATCGTCATATTACTCGTTGGAGTTG
GATCCACTGTTGAGTGATCTCGCAGAGAAGAAGCTTAGCCTGAGGAGAAGCTTGGCTTGG
CTGGATGCAGAGCTCAAGGATGCCAAGATCAAGCTTGCTTCCAAGGAACAGTTGCTTGCT
CAGGAATCAGAAAACAGGAAGAAGTTTGCTGAGTCGAGGGCGAGAAGCATGGAGGAGGAG
GTGAAGAAGCTGCATAAATGTTTACAGGACAAGGATGAGCAGCTGCGAACATCAATATGT
AGCACTGAACAGCAGTATTTGTCTTCCTACAAATTGGATATTCTTAGATCACAGATTTCA
GTGGCACAAGCCACTGCAGAAGCCAGTGCAGAATCAGCCATGTTGGCACGGTTGCAGTGC
TTGTCCCTGTCAGGAGGGCATGAGAAGATCAATTCTTTGGGTGAATGCGAGCTTCGAGTG
AAGAAGGTAGAGGAGCAGCTAGATCTTGTTCAGAAGTTCCTTGAAGCGAAAGAGCTCTCG
CAGTTGGAGAAGAATCAAATGACAACGGTTCATGAGCTGAAGAAGAAGGTACTGAAACTT
GAATGCACCCTCAAAGTATCAAGAGCTCAGCTGCGAAAACTACATAAGATGGTAGAGCGA
AGAGATAAACCTCTCAAAAAACTACAAAGCCGATTGCCGCTGAAGCAGCAGACCGCCTGC
GACAAGCAGAAGTTGTGGGAGAGCTCAGGCTTCAGGATCATAGCCTCCATGTCAATATTG
GCCCTGGCTATGCTGTCGAAGCGATGAACTGAACAAGTGATGATTGACGTCGTCGTGTAT
CAGTTGTCTATGGCAGACGCAAATGTTCCTGTATTGGTGTCAGGGTTATGAGATAGTTGA
TGGTATGAATGATAAATCTGTGTAGCATCATTACCAGTTCTCCGTACCAAATTTGACGAA
ATTCAGTGTACTGTCGTAGACTTCAGCGTGGTGGAAACTTAAACCAATGCACTAAATGAA
CTTGGGG

CDS

807 bp

>Os01t0292700-01 Intermediate filament, Cytoskeleton protein, Tolerance to salinity and heat stress
ATGCCGATTTCAGAGAGGGCAACAACAACGCCATCATCGTCATATTACTCGTTGGAGTTG
GATCCACTGTTGAGTGATCTCGCAGAGAAGAAGCTTAGCCTGAGGAGAAGCTTGGCTTGG
CTGGATGCAGAGCTCAAGGATGCCAAGATCAAGCTTGCTTCCAAGGAACAGTTGCTTGCT
CAGGAATCAGAAAACAGGAAGAAGTTTGCTGAGTCGAGGGCGAGAAGCATGGAGGAGGAG
GTGAAGAAGCTGCATAAATGTTTACAGGACAAGGATGAGCAGCTGCGAACATCAATATGT
AGCACTGAACAGCAGTATTTGTCTTCCTACAAATTGGATATTCTTAGATCACAGATTTCA
GTGGCACAAGCCACTGCAGAAGCCAGTGCAGAATCAGCCATGTTGGCACGGTTGCAGTGC
TTGTCCCTGTCAGGAGGGCATGAGAAGATCAATTCTTTGGGTGAATGCGAGCTTCGAGTG
AAGAAGGTAGAGGAGCAGCTAGATCTTGTTCAGAAGTTCCTTGAAGCGAAAGAGCTCTCG
CAGTTGGAGAAGAATCAAATGACAACGGTTCATGAGCTGAAGAAGAAGGTACTGAAACTT
GAATGCACCCTCAAAGTATCAAGAGCTCAGCTGCGAAAACTACATAAGATGGTAGAGCGA
AGAGATAAACCTCTCAAAAAACTACAAAGCCGATTGCCGCTGAAGCAGCAGACCGCCTGC
GACAAGCAGAAGTTGTGGGAGAGCTCAGGCTTCAGGATCATAGCCTCCATGTCAATATTG
GCCCTGGCTATGCTGTCGAAGCGATGA

Protein

269 aa

>Os01t0292700-01 Intermediate filament, Cytoskeleton protein, Tolerance to salinity and heat stress
MPISERATTTPSSSYYSLELDPLLSDLAEKKLSLRRSLAWLDAELKDAKIKLASKEQLLA
QESENRKKFAESRARSMEEEVKKLHKCLQDKDEQLRTSICSTEQQYLSSYKLDILRSQIS
VAQATAEASAESAMLARLQCLSLSGGHEKINSLGECELRVKKVEEQLDLVQKFLEAKELS
QLEKNQMTTVHELKKKVLKLECTLKVSRAQLRKLHKMVERRDKPLKKLQSRLPLKQQTAC
DKQKLWESSGFRIIASMSILALAMLSKR*

CDS

chr01:10643287..10643487 (+ strand) : 201 bp

chr01:10643564..10643674 (+ strand) : 111 bp

chr01:10643817..10644047 (+ strand) : 231 bp

chr01:10644177..10644281 (+ strand) : 105 bp

chr01:10644470..10644628 (+ strand) : 159 bp

3'UTR

chr01:10644629..10644848 (+ strand) : 220 bp

FASTA

>Os01t0292700-01 class=Sequence position=chr01:10643287..10644848 (+ strand)
ATGCCGATTT CAGAGAGGGC AACAACAACG CCATCATCGT CATATTACTC GTTGGAGTTG GATCCACTGT TGAGTGATCT
CGCAGAGAAG AAGCTTAGCC TGAGGAGAAG CTTGGCTTGG CTGGATGCAG AGCTCAAGGA TGCCAAGATC AAGCTTGCTT
CCAAGGAACA GTTGCTTGCT CAGGAATCAG AAAACAGGAA GGTATGTTCC ACTCTCCTAA TCATGACTTC TCGATGTTCT
GTGAAAAAAC AATTGCACTG AATTGATGAA ATATTAGAAG TTTGCTGAGT CGAGGGCGAG AAGCATGGAG GAGGAGGTGA
AGAAGCTGCA TAAATGTTTA CAGGACAAGG ATGAGCAGCT GCGAACATCA ATATGTAGCA CTGAACAGGT GATCATCACC
CCCTTATACT ACACTTACTG TCAATCTTCC AGTGTGATGT GTTCAGGTAA CTGTTATGTT TTGGTGTAAT ATTTTTTTTT
GACCTAGTAG TTTCATCAAC TGCAAATCAA ATGGGAAATT TTCATGTCAG CAGTATTTGT CTTCCTACAA ATTGGATATT
CTTAGATCAC AGATTTCAGT GGCACAAGCC ACTGCAGAAG CCAGTGCAGA ATCAGCCATG TTGGCACGGT TGCAGTGCTT
GTCCCTGTCA GGAGGGCATG AGAAGATCAA TTCTTTGGGT GAATGCGAGC TTCGAGTGAA GAAGGTAGAG GAGCAGCTAG
ATCTTGTTCA GAAGTTCCTT GAAGCGAAAG AGCTCTCGCA GGTCGTTATA CGCTTACAAG TTACAAATTA ATTACTTCCT
TGATCCACAA AATACATTCA TTTAGTATGT TTTTATATTG AAATTTTAAA TTATGCTTTT ATTCAATTTA AATTTGTTGG
TAATATATAG TTGGAGAAGA ATCAAATGAC AACGGTTCAT GAGCTGAAGA AGAAGGTACT GAAACTTGAA TGCACCCTCA
AAGTATCAAG AGCTCAGCTG CGAAAACTAC ATAAGGTACT ATGCTTACCA CTTGCAATAT TCAGGGAATG ATTTTCACCT
TCAGAGGATT ACTGATCAAC ATGAGTGCAA TCACATTTTT TTTCATTTCC TGAAAATTAA CCATCTATCT TCTCTCTGCT
AATCTAATCA TATATGTAGT TGGAATATCT TGCAATCATA CATGTTTAAT CTTCCTTATG TAGATGGTAG AGCGAAGAGA
TAAACCTCTC AAAAAACTAC AAAGCCGATT GCCGCTGAAG CAGCAGACCG CCTGCGACAA GCAGAAGTTG TGGGAGAGCT
CAGGCTTCAG GATCATAGCC TCCATGTCAA TATTGGCCCT GGCTATGCTG TCGAAGCGAT GAACTGAACA AGTGATGATT
GACGTCGTCG TGTATCAGTT GTCTATGGCA GACGCAAATG TTCCTGTATT GGTGTCAGGG TTATGAGATA GTTGATGGTA
TGAATGATAA ATCTGTGTAG CATCATTACC AGTTCTCCGT ACCAAATTTG ACGAAATTCA GTGTACTGTC GTAGACTTCA
GCGTGGTGGA AACTTAAACC AATGCACTAA ATGAACTTGG GG

Locus: Os01g0292700

Loading...

Locus: Os01g0292700

Loading...