Os01t0302500-01

Locus

Os01g0302500

Description

Knotted1-type homeobox protein OSH6.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

OSH6

CGSNL Gene Name

HOMEOBOX 6

Oryzabase Gene Symbol Synonym(s)

OsH6, HOS16

Oryzabase Gene Name Synonym(s)

Oryza sativa homeobox6, Rice KNOX gene-6, Homeobox protein knotted-1-like 1, Homeobox protein OSH6, Homeobox protein HOS16, Oryza sativa Homeobox 6

Transcript Evidence

AK241312 (DDBJ, Best hit)

Protein Evidence

Q9FP29 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Cellular Component: nucleus (GO:0005634)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: sequence-specific DNA binding transcription factor activity (GO:0003700)

Molecular Function: protein binding (GO:0005515)

Molecular Function: sequence-specific DNA binding (GO:0043565)

Functional domain (InterPro)

Homeobox (IPR001356)

ELK (IPR005539)

KNOX1 (IPR005540)

KNOX2 (IPR005541)

Homeobox KN domain (IPR008422)

Homeodomain-like (IPR009057)

Homeodomain-related (IPR012287)

Homeobox, conserved site (IPR017970)

Full-length cDNA

J065141L09 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0302500-01)

Others

Oryzabase (2977)

KEGG (Os01t0302500-01)

Transcript

1523 bp

>Os01t0302500-01 Knotted1-type homeobox protein OSH6.
AGCTGCTGAATTCCCCCATGAGCCTCTGCCTCCCTGCCTGCCCCCGTATGTAGCAAGAAC
AAGAACACCAGCGAGTAACACAGGCTCGCTACAGTGGTACTAGATTACCGCTTGTGCGGG
CATAGTGATCGTCTATAGTTGTGAATTGCGATGCAGCAGCATAGGTGGTGAGCTGCTGCG
GCTGCTGCTGCTGGTACGTAGATGGAGGATCTGTACAGCATCCACCCGGGGATCTCGCGG
GTCGGCGGCGCGGCGAGCGAGGCGTCCGGCGTGGGCGTCGTCGTCGGCGGCGGCGGCGGG
TCGTCGTCGTCGGATCTGACGGAGCTCATGAAGGCTCAGATCGCCGGTCACCCGCGCTAC
CCGACCCTCCTCTCCGCCTACATCGAGTGTCGCAAGGTGGGAGCGCCTCCGGAGGTGGCG
TCGCTGCTGAAGGAGATCGGCCGGGAGAGGCGCGCCGGCGGCGGCGGCGGCGGCGCCGGG
CAGATCGGCGTCGACCCCGAGCTCGACGAGTTCATGGAGGCGTACTGCCGGGTGCTGGTG
CGCTACAAGGAGGAGCTGTCCCGGCCGTTCGACGAGGCGGCGTCTTTCCTCAGCAGCATC
CAGACGCAGCTCAGCAACCTCTGCAGCGGCGCCACCTCGCCGCCGGCCACCACCGCCACG
CACTCCGATGAAATGGTGGGGTCCTCCGACGAAGACCAGTGCTCGGGGGAGACTGATATG
CTAGATATAGGGCAAGAGCAAAGCTCCCGCTTAGCTGACCACGAACTCAAGGAAATGCTT
CTGAAGAAGTACAGTGGCTGCCTCAGCCGGCTCCGGTCCGAGTTCCTGAAGAAGCGGAAG
AAAGGGAAGCTACCAAAGGACGCACGGTCGGCACTGCTTGAATGGTGGAACACACACTAC
CGCTGGCCATATCCCACGGAAGAAGATAAGCTGAGGCTTGCAGCGAGGACAGGTCTTGAC
CCAAAGCAGATCAACAATTGGTTCATCAACCAGAGGAAGAGGCACTGGAAGCCATCGGAC
GGGATGCGGTTCGCGCTCATGGAGGGCGTGGCGGGTGGATCGTCCGGGACGACGCTCTAC
TTCGACACTGGCACAATTGGACCATGAATTCATTTTTGAGCAATGCCGCCTCTTGAGAAA
ATTGGCCATTTAGGCAGTAATAGTAGGACATGGTATTTGGTGGTGATTGTGTCTAGCTAT
GATCAATCTTTCAGCAGGTCAGTGTTATTCAGTTCAGGGTAAAGTAATTGCCTCATTGTT
TTGGCAGATCATGTGTATATGGCATCGTACCAAATCAAAATGTATAATCGTTAGGTAATA
TATATCTTGGGGAGACCTGAAAAGGCTGTTATTAGTAGTTTCATGTAATGGCTCAACTCA
AGGGTTGTGAGTAATCTTTGTCCACACTGCGTACCCAGCTGGACTGTTAGATAGGCCGAG
GACTTGAAAAAGGTAAGTTTACCTGTACTAAAATGTTTGCCTATTATTTTGTCTATATTT
ATAAATTCATTTGTTCGGACTTC

CDS

906 bp

>Os01t0302500-01 Knotted1-type homeobox protein OSH6.
ATGGAGGATCTGTACAGCATCCACCCGGGGATCTCGCGGGTCGGCGGCGCGGCGAGCGAG
GCGTCCGGCGTGGGCGTCGTCGTCGGCGGCGGCGGCGGGTCGTCGTCGTCGGATCTGACG
GAGCTCATGAAGGCTCAGATCGCCGGTCACCCGCGCTACCCGACCCTCCTCTCCGCCTAC
ATCGAGTGTCGCAAGGTGGGAGCGCCTCCGGAGGTGGCGTCGCTGCTGAAGGAGATCGGC
CGGGAGAGGCGCGCCGGCGGCGGCGGCGGCGGCGCCGGGCAGATCGGCGTCGACCCCGAG
CTCGACGAGTTCATGGAGGCGTACTGCCGGGTGCTGGTGCGCTACAAGGAGGAGCTGTCC
CGGCCGTTCGACGAGGCGGCGTCTTTCCTCAGCAGCATCCAGACGCAGCTCAGCAACCTC
TGCAGCGGCGCCACCTCGCCGCCGGCCACCACCGCCACGCACTCCGATGAAATGGTGGGG
TCCTCCGACGAAGACCAGTGCTCGGGGGAGACTGATATGCTAGATATAGGGCAAGAGCAA
AGCTCCCGCTTAGCTGACCACGAACTCAAGGAAATGCTTCTGAAGAAGTACAGTGGCTGC
CTCAGCCGGCTCCGGTCCGAGTTCCTGAAGAAGCGGAAGAAAGGGAAGCTACCAAAGGAC
GCACGGTCGGCACTGCTTGAATGGTGGAACACACACTACCGCTGGCCATATCCCACGGAA
GAAGATAAGCTGAGGCTTGCAGCGAGGACAGGTCTTGACCCAAAGCAGATCAACAATTGG
TTCATCAACCAGAGGAAGAGGCACTGGAAGCCATCGGACGGGATGCGGTTCGCGCTCATG
GAGGGCGTGGCGGGTGGATCGTCCGGGACGACGCTCTACTTCGACACTGGCACAATTGGA
CCATGA

Protein

302 aa

>Os01t0302500-01 Knotted1-type homeobox protein OSH6.
MEDLYSIHPGISRVGGAASEASGVGVVVGGGGGSSSSDLTELMKAQIAGHPRYPTLLSAY
IECRKVGAPPEVASLLKEIGRERRAGGGGGGAGQIGVDPELDEFMEAYCRVLVRYKEELS
RPFDEAASFLSSIQTQLSNLCSGATSPPATTATHSDEMVGSSDEDQCSGETDMLDIGQEQ
SSRLADHELKEMLLKKYSGCLSRLRSEFLKKRKKGKLPKDARSALLEWWNTHYRWPYPTE
EDKLRLAARTGLDPKQINNWFINQRKRHWKPSDGMRFALMEGVAGGSSGTTLYFDTGTIG
P*

5'UTR

chr01:11167043..11167243 (+ strand) : 201 bp

CDS

chr01:11167244..11167438 (+ strand) : 195 bp

chr01:11167597..11167716 (+ strand) : 120 bp

chr01:11167903..11168053 (+ strand) : 151 bp

chr01:11173341..11173591 (+ strand) : 251 bp

chr01:11173847..11174035 (+ strand) : 189 bp

3'UTR

chr01:11174036..11174451 (+ strand) : 416 bp

FASTA

>Os01t0302500-01 class=Sequence position=chr01:11167043..11174451 (+ strand)
AGCTGCTGAA TTCCCCCATG AGCCTCTGCC TCCCTGCCTG CCCCCGTATG TAGCAAGAAC AAGAACACCA GCGAGTAACA
CAGGCTCGCT ACAGTGGTAC TAGATTACCG CTTGTGCGGG CATAGTGATC GTCTATAGTT GTGAATTGCG ATGCAGCAGC
ATAGGTGGTG AGCTGCTGCG GCTGCTGCTG CTGGTACGTA GATGGAGGAT CTGTACAGCA TCCACCCGGG GATCTCGCGG
GTCGGCGGCG CGGCGAGCGA GGCGTCCGGC GTGGGCGTCG TCGTCGGCGG CGGCGGCGGG TCGTCGTCGT CGGATCTGAC
GGAGCTCATG AAGGCTCAGA TCGCCGGTCA CCCGCGCTAC CCGACCCTCC TCTCCGCCTA CATCGAGTGT CGCAAGGTAT
GGCTAAGCTA GTTTATGCTC TTCCTACGTG AGATCGATCT TGGTGGTTGT ACCTTGTGAA TGCCAAGAAT TGGGCAAAAG
AAGAAGAATA CTTGTTAATT TGTGACACTG TATATATGCG TCTAATTCAT GGTTGTGTTT CTTGGTGGTT TGAGGTGGGA
GCGCCTCCGG AGGTGGCGTC GCTGCTGAAG GAGATCGGCC GGGAGAGGCG CGCCGGCGGC GGCGGCGGCG GCGCCGGGCA
GATCGGCGTC GACCCCGAGC TCGACGAGTT CATGGTTCGA ACCCTTTGAC ACACCCTGTC GCAGCGATGT GATGACAATT
AAATTCGCCG TGTGATTTCT GTGGTGACCG GCGACGACTA GACTAGATTT CTCTCCTCAC CCAGCCCAAT CCGTTGCTTG
ATTGATTATT ATTATTACAT GTGCACATGC GCGCGTGTGT GTTGTTTGTT AATCACACAG GAGGCGTACT GCCGGGTGCT
GGTGCGCTAC AAGGAGGAGC TGTCCCGGCC GTTCGACGAG GCGGCGTCTT TCCTCAGCAG CATCCAGACG CAGCTCAGCA
ACCTCTGCAG CGGCGCCACC TCGCCGCCGG CCACCACCGC CACGCACTCC GGTAACCAAC ATATTCACTA CATTTGCATG
CATACATGGC AGTAGTAGTA CTGCGCTTCT TGTTTTCTTT TCTTTTTTTT TTTTTGGGTA TACATCGCAT TGTGTGTGTA
TGCTAGTAGT AGCTTTGTTG CTGTTGGGAG AATGGAGAGA AACCGTGTGC GTGTAACAAT GGTGTTCTTG TGAGAGGTCA
AATCGTGTCC ATGCAAATGG GGAGCAGGAG TGTCAGAGGG AGAGGGAAGG GTGGAGTAAA ACCATTGGGA AGTTGCTTGT
GTAGGGTTTT GTCCAAGGTT TGTAGGCTTC TTTCTCTCCT TTTTTTTTCT CTCTGCAATT CTACATACAC ATAGCCATAT
CTCATCAACT CCGGGtagtt ctaaattttt tcttcaaact tctaactttt tcatcacatt aaaactttcc tacacatata
aacttctaac ttttccatca catcattcca atttcaaact ttggcgtgaa ctaaacacac cctCCCTTGC CTTGCGTGTG
TCTCCTGGCC CAGTTTAGAT CCcactgtca catcgaacat ttaaaaagga ttaaatatat gctaaaaaaa taaataattg
tatagattgg actaatttgc gagatgaatc ttttaaacct aattactcca tgaattgaca atgtgatgct gcagtaaaca
tttgctaatg atggattaat taggcttaat aaattcatct cgtggtttcg tttaccaatg gattttgtaa ttagtttttt
tattagtgtt cgaacacccc atgcgacacc ctatataata cccgatgtca cacgcgctta tctaaacacc cAAGTGTTTG
TGTGGCTAGC TATAGCCTTT CGTAGCTAGT AGGCTGGTTG ATGGAACCTG AGCTTGCTTT GACAAAAGTG AGAATCTTTG
CTCTTGCCTG CAAGCTATGG CTATGGTAGC CACCTGCGGT TACAACCAGC GGTTGTGTAC TGAGCAGTGA GTGAAAAAAA
AAACTGTAAA ACTAAGTTTT TTTATTAGGG TCCGTGGTTA GGAGATCTCT TGCCGGATTC GGTTGCTGTA CTTTGACAAG
ACGTATCAAT ATCTCACTAC GGTAGTGGTA ATTTCTGGTG GTGAGTTTTG TTTTCTCTAC ATTTTTTTTG TTGTGTAAAA
ATATTGTTGC AGTAGTAGTA GTAGTAGTAC AAACTTGTTT TCTTTTCTTC TCAACACGTT GGAGGTGTGG GATTGGATCG
CTTGTCTTTT TACGGATGCT AATTGAAAGC ATAATATAGT AGTTTTCACA AATCTTTGGC TATAGGAAAT GTAGTGCTTA
TGTTTGCTAG CCATCCAGAT TCACTATTTT ATGGAGATAA CTGTGGTTAT TCCTGTCATA TCGGATGATT TGAAGAGATG
AACACTGATG GGACGTTTTG AGGGGGTATG GTAGCTAGGC ATGTAGGAGT AGAAATTTAt gttaccaaca gattagtagt
gatatcgtac aatgccttag gctgtgttta gtttcacacc aaaattgaaa gtttgaagaa attggaacga tgtgacggaa
aagttggaag tttgtgtgtg taggaaagtt cgatgtgacg gaaaagttgg aagtttgaag aaaaaagttg gaatctaaac
agggccttaG TATTAAAGGA TATATTTAAT TAAGGGGTTA TTTTCTAAAG TAACGATAGA CCTATCTCTT CCTTGATGTT
GAAAACTTTT TCTGCAAATT GCAAAATAAG ATTTTATTGG ATTGTGAAAG ATGAATTATT TACCCATGAA GTTGTTTTTT
ATCACTACTA CTGATTGAGC ACTACTGAAT TGCAAATTGT CAACCTTGCT AAGGTAAATC TTTTTAATAA GACCTGATAG
TAACAATAGA GCAATATAGC GATCAGTGTT AAAATAAAAA AGTTATAGTA GGAATATTGG ATTTTTATAA TTGATATCTG
AATGCTTcat attaattcac ttgttgttct agattgttta gcataaatca aggtttggga agagaagact ataatgtctc
ttatttgaat gaaagtagga ggatggcgag gataggatgg gtagaaattt gaattggatg tgattgatgg gacaacttgt
actcttaagt gacaactagt gtgggataaa ttttaaacta taaagagaac tattttggga cggggaaagt aTTATATAAG
AAGACAATAA TTCCATATTT TGATTTGACA AGATTGTGCA GTTCTCTGTT TTTCTATTTT TTTTAAAAAA AATTGTTGAA
CTGAGTATAC AGAGATTCCA AAAGGCAAGT GAAATTAAAG ATCAATATGC CGATAGTTTG CCTGTTATTC TGGATTATTC
TAGCATATGC AAACTGGATT TCTGGATTTT TGGAAGAATT CCTTATAATT CCAGCCGCAT TTTTAAGTAG TTTGGAGTTT
TGCACAGTAA TTAATATGGT AGATAGCATA ATTTCCTGTA TGCCTTTCAT ATATTCATAC AGAAAAGATG ATTGTTATAT
TTAGCAGAGT AATAGTGTTT ATGTAGCAAT ATTGCAAAAG CAGTACAGTT GACGAAATAA CAGGAAGATG GACTTAGGGT
TTACACTTAT ATACAAACTT TCTTAGGTCC CCCACATGTC GCTGGGCCCT GGCCAGAAGG GGAGCTAGTT CCTAACAGCT
AGGCATTCCC ACTATGAGAA GAAAAAAATC ACAGCTGGGG ATGATTGGAT ATCGAGCCCA TTATTACCAT TTCTATCCAT
GGATATCTCA TTTTCTGAGT TTCATCTTTG AAGTGAGCTT AGTGAGACTA CAATGATCTT TTGGCACAAG TGGCGGGCCC
AATCTAAAAT TTTAGATATG GCACAGTAAA ATATATGAGT AAAATTTCTT CAATCCCTCC TTACCAAGCC AATTAATCAC
TTAATTAACA TATAATCTAA ATTTTGAAGC AGATTAGTAA AGTAAAGTAA AGAACCAAAT TTCCCCTTAA GTAGTAAAGC
GGCATTGCAG CAAGTTAGCT CCTCATCTTA GCGCTGTTAC CACCCTCACC AATCCATGAA TGGCTGCTTG GGGTCCTAGG
CAGCTCGGAT ATGAAGGAGT ATATAGGCTA TCTATGCAGT AGTGTAGCTA TGGCAGCTGC CACAGCATGC CACAAGGGAG
GGTCTGCCCC TTCACATCCA AAAGTTGTAT TATTGCTTAT GGACATATAT CAGGAATTAC CTATTCATTA TGCTTTATGT
GCCAAACTGC TTCTGAAGGT GTTTCATGTT AGCTTGCAAA AAGTTTTTGT TTGTGTATAA TTTATGAACT GATTTTATTC
ACAAAACGCT AGTGATAATA CGGTCCTTGA CTTGTGTTAT GCGTGGTCGC TCGCTACACA CTTTTTCTGC TCTTAATcta
ttatattatc agccttaaaa ggagacacca cgttcgccct agaggctaga aattcttaca ttaatcagag aaaaagaaaa
agatattaac cgttacatca tagtgggtcc ggattataac ggtataggtt gattgatatt gttgtataca aaattcaatt
gtatctatag aaatagaagt taagagttgt ataTGAAATC TAAGCCTATA AAAATAGAAT CTAAGAGTTC TATATGAAAC
CAGACCTTAT AGAAAATATA ACCTAAGAGT TGTATATGAA ATCCAAATAG ACTTCTACAT ATAATGGTAC CTGTAGAAAC
AAAATTTCAG AGTTTACTCT ACATGAATTA TCTAGCTCCG TGCAAAACTG CCTGGGGGCA ATTACTTGAT GGTTTCTGTC
GTGTCAAGTT GGCAGCATTG ATAGTCTGGC AAAGAAGGAA AAAGGCAAAG CCTTAGTTCT GCCAAGAGAA TATATATATG
TACCTCCAAA GTAGGTCCAC CACAAGTGAT AGCTCCATGA TGTATGTCTG TTGTTTCCAA AAAAAACATG ATGTATGTCT
GCTGCAGGCA GACCTCACAA TATTATATAG GAAGTATGGT TTGGAATAAT ATAGCTGTGA AGACATTGCA AATGGGAACT
TTTCTTGGAT GGTAAAAAAT GTTAATATTG CGGAGACTTG AATATGAATA CAGATTATGT TTGACTGTTG TTGGAGCCTA
TGTTGGTTTC GTGTGAAACA TGTATGGCAA TTTTCATCAC CTACTTTTTA TTGTGAAATT CGGCTTTCAC TATTTGAAAA
GGTGAACTTT GAATTTATCA TTACCTTTTG CCTTACTAGC CGTAATGTCG CATGCTGCCG AAACAAGGAA CTGTTTTGAG
AATCTAATTG TAATTGGGTT ATAGGGATAG AGGCACTTGG TATTTCTTAA AAATGTAAGT TTCAAATGTA CATAAGTTGA
TGGCTTTATA AATATAATGA CATGTGAGAC AAGGGGAACT CGGATTGCAT TTCCTTAAAA GTCATTGTCC TTACTAGTAC
ACTGAAACAT TTCTCCAAAA GACTATAGTG AGAAAAGGGT TCTTAATTAA CTTATACCAT AGGGATTTTG CCTATCTGTT
AAATAAACCT TCCATGCATT GTTGACCTCA TGAGAACTTC TTGAGTCGAT CTATGATTGT TGAGCTAACA CAAGATACTA
ATACTGTATA ACAAAAGAAA CTCTCTTGAT TTGTAATATT ACATACACTA CACTTTCAGT TTAACAAAAA AGATGGTATT
TTATACATCT GCAAATTGAT TGTTTAACAT GGCTTTGGTT TTGTTTTTGT CCCCATCTTG CTAGTATTGT CCAAAATTTA
AAAAATAATT AACTTAGTGT TTTTATTACA GTTCTGCTTC TGTAGAAGTT ATGTAGAATT TTCTCCTTTT TTATGTTCTA
ATACATTTCT TTGGTGAACT AATGGCATGG AAATACTTTG CAATATATAT ATTACTTGTT TTGAAAGAAC ATCAATCAAG
ATGCTCAAAT TCATCCCTGC CAGTCTAGAA TTTGGCCCTG TTTTTCTTCC TTGGAATCAT GTTCTGGGCT TCTGACGATG
GGAATTTGGG ACTACAAGCA TGCTAATTTT TGCTGCTCAA TTCTGAAGGA TATGGGCATA TGGCATTAAT TTTCTCTAAT
ATAGCTTGAT ACTTGTTTTT TTGAATTATT GATATCTCCA TCTATGGAAT TGATTTCTAT ATATATTGTG AATTGTAACT
TGGTGCGCCC AACACTATTA ATTGTGAATC ATGACCCATA TTTTCTAGTT TTAGTTTTTC CCATTTACTC TGTAAGCATA
TTTCTCAGGA ATGTCATGCA AAATGGTTAT CCCTCGCTCA TTTATAATTT CATGGCAGAT GAAATGGTGG GGTCCTCCGA
CGAAGACCAG TGCTCGGGGG AGACTGATAT GCTAGATATA GGGCAAGAGC AAAGCTCCCG CTTAGCTGAC CACGAACTCA
AGGAAATGCT TCTGAAGAAG TACAGTGGCT GCCTCAGCCG GCTCCGGTCC GAGTTCCTGA AGAAGCGGAA GAAAGGGAAG
CTACCAAAGG ACGCACGGTC GGCACTGCTT GAATGGTGGA ACACACACTA CCGCTGGCCA TATCCCACGG TAATATGATC
ACTGTGTTTC CTTTTCTGta gagatggaag tgggcaatcc cgctacctat ataaaaaccc gcattacagt tcattttcta
cttgctagta caaaatttag aagaaaatat caactaaaat tgtgataagc gggcaagaaa agcccgcttg tctgccccac
ttgcatccct tctTTTCTGT AACTGAAATT TTGTGGTACA TTATGTTAGT ATATATTGTC TGACGTTGTG GTGCTGATTG
ACAGGAAGAA GATAAGCTGA GGCTTGCAGC GAGGACAGGT CTTGACCCAA AGCAGATCAA CAATTGGTTC ATCAACCAGA
GGAAGAGGCA CTGGAAGCCA TCGGACGGGA TGCGGTTCGC GCTCATGGAG GGCGTGGCGG GTGGATCGTC CGGGACGACG
CTCTACTTCG ACACTGGCAC AATTGGACCA TGAATTCATT TTTGAGCAAT GCCGCCTCTT GAGAAAATTG GCCATTTAGG
CAGTAATAGT AGGACATGGT ATTTGGTGGT GATTGTGTCT AGCTATGATC AATCTTTCAG CAGGTCAGTG TTATTCAGTT
CAGGGTAAAG TAATTGCCTC ATTGTTTTGG CAGATCATGT GTATATGGCA TCGTACCAAA TCAAAATGTA TAATCGTTAG
GTAATATATA TCTTGGGGAG ACCTGAAAAG GCTGTTATTA GTAGTTTCAT GTAATGGCTC AACTCAAGGG TTGTGAGTAA
TCTTTGTCCA CACTGCGTAC CCAGCTGGAC TGTTAGATAG GCCGAGGACT TGAAAAAGGT AAGTTTACCT GTACTAAAAT
GTTTGCCTAT TATTTTGTCT ATATTTATAA ATTCATTTGT TCGGACTTC