Os01t0307500-01

Locus

Os01g0307500

Description

Na+ transporter, A member of HKT (high-affinity K+ transporter)-type transporters, Regulation of K+/Na+ homeostasis, Salt tolerance

RAP-DB Gene Symbol Synonym(s)

SKC1, OsHKT1;5

RAP-DB Gene Name Synonym(s)

high-affinity K+ transporter 1;5

CGSNL Gene Symbol

HKT8

CGSNL Gene Name

HIGH-AFFINITY K+ TRANSPORTER 8

Oryzabase Gene Symbol Synonym(s)

OsHKT8, Os-HKT1;5, OsHKT1;5, HKT1;5, SKC1, qSKC-1(t), OsSKC1

Oryzabase Gene Name Synonym(s)

shoot K+ concentration (QTL)-1(t)

Transcript Evidence

AK108663

DQ148410 (Nona Bokra)

Protein Evidence

Q0JNB6

Literature

PMID: 28488420

PMID: 16155566

Note

Manual Curation

May 31, 2018

Gene Ontology (GO)

Biological Process: cation transport (GO:0006812)

Biological Process: transmembrane transport (GO:0055085)

Molecular Function: cation transmembrane transporter activity (GO:0008324)

Functional domain (InterPro)

Cation transporter (IPR003445)

Full-length cDNA

002-148-F10 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0307500-01)

RiceXPro (AK108663)

Others

Oryzabase (9022)

KEGG (Os01t0307500-01)

Transcript

2163 bp

>Os01t0307500-01 Na+ transporter, A member of  HKT (high-affinity K+ transporter)-type transporters, Regulation of K+/Na+ homeostasis, Salt tolerance
GCTGTTGCTCTTGTTCACTTGTGCTCACAGCACCTGGTAACCCCACATACAGTGATCACA
CAACAAACAATATCTGTTGTTTGTGTATAAATAGCCCTAACATGGCTTCCTAATTCCTAT
AAACAACAAGTGTGAGAAAACCCAAGAACGAAACACATAGGAGAGAAATGAGTTCTCTGG
ATGCCACTACTCCTAGATATGACGAGTTTAAAAGGATCTACCACCTTTTCCTTTTCCATG
CACACCCATTCTGGCTCCAACTGCTGTACTTCCTCTTCATCTCCCTCTTGGGTTTCTTGA
TGCTGAAAGCTCTGCCGATGAAGACCAGCATGGTGCCGAGGCCCATGGACTTGGACCTGA
TCTTCACGTCGGTGTCGGCGACGACGGTGTCGAGCATGGTCGCCGTCGAGATGGAGTCCT
TCTCCAACTCCCAGCTCCTCCTCATCACCCTCCTCATGCTGCTTGGTGGTGAGGTCTTCA
CCAGCATCCTTGGCCTCTACTTCACCAACGCCAAGTACTCCTCCAAGATGATAGCAACCT
TACCTGATGATGACGACCATGGTGGCAGTGGCAAACCACCACCACCAACGACGTCACCTT
CGTCTACCCTAGTGGAGCTCGAGCTCGCTCCTCCCATGGACGTCGTCGTCGTCAACCCTA
CCACCACTGCGACGACGCACGACGAGGTAGAGCTAGGGTTAGGACGTCGGAACAAGCGCG
GCTGCACCTGCACTACTACTCACACGTCGTCGTCATCATCGGCATCGAAGACGACGACGA
CGAGGCTACTGATGTTCGTGGTGATGGGGTACCACGCGGTGGTGCACGTCGCCGGGTACA
CGGCCATCGTCGTGTACCTCAGCGCCGTCGGCGGCGCGGGGGCGGTGGTCGCCGGGAAGG
GGATCAGCGCGCACACGTTCGCCATCTTCACCGTCGTCTCGACGTTCGCCAACTGCGGGT
TCGTGCCGACGAACGAAGGGATGGTGTCGTTCAGGTCGTTCCCGGGGCTCCTCCTCCTCG
TCATGCCGCACGTCCTCCTCGGGAACACGCTCTTCCCGGTCTTCCTCAGGCTGGCCATCG
CCGCGCTCGAGAGGGTCACCGGGTGGCCGGAGCTCGGCGAGCTCCTGATCCGGCGGCGGA
GGGGCGGCGGCGAGGGCTACCACCACCTGTTGCCGAGCTCGCGCACGCGGTTCCTGGCCC
TCACCGTGGCCGTGCTCGTGGTGGCGCAGCTGGCGCTCTTCTGCGCCATGGAGTGGGGCT
CCGACGGGCTGCGGGGGCTCACCGCGGGCCAGAAGCTCGTCGGCGCGCTCTTCATGGCGG
TCAACTCGAGGCACTCCGGTGAGATGGTGCTCGACCTCTCCACCGTGTCGTCGGCCGTCG
TCGTGCTCTACGTGGTGATGATGTACCTGCCACCTTACACCACTTTCGTACCTGTCCAAG
ACAAACACCAGCAAACGGGAGCACAGTCCGGGCAGGAGGGCAGCAGCAGCAGCAGCATAT
GGCAGAAGCTGCTCATGTCGCCGCTCTCGTGCCTAGCCATCTTCATCGTCGTCATCTGCA
TCACGGAGCGGCGGCAAATCGCCGACGACCCCATCAACTACAGCGTCCTCAACATCGTCG
TCGAGGTTATCAGTGCGTATGGCAATGTGGGGTTCAGCACGGGGTACAGCTGCGCGAGGC
AGGTGAGGCCCGACGGCAGCTGCAGAGACCTGTGGGTTGGCTTCTCAGGGAAGTGGAGCA
AACAAGGGAAGCTCACTCTCATGGCCGTCATGTTCTACGGCAGGCTCAAGAAGTTCAGCC
TGCACGGTGGTCAGGCATGGAAGATAGAATAACGCCTAACTGCAAGCACCCATGCATGCA
TGACAACTTCGTTACTAATTAATGGGGCATTTCAGCCGGCCGCCGTACTAGACTACAAGA
GATCGATCGATAGGTCTCCCCTCCTAAAACTCCTCCTTAATCTGATCTCCACGAGTTCTT
GATCAGGGTTACTTATATATTATAAAGGAATGATCAGATAAATATATGTCTATATCAGGA
TCTGGTCGATCTCTAGATATCTGTCTTTTTTTTTTTTGGGTAATGCATGTAAGCAAGTAG
CAATTGCTAGACATATATATGTGTTAGCTTACGAGAGTATATACTGGCGCTTGAGTCGTG
ATG

CDS

1665 bp

>Os01t0307500-01 Na+ transporter, A member of  HKT (high-affinity K+ transporter)-type transporters, Regulation of K+/Na+ homeostasis, Salt tolerance
ATGAGTTCTCTGGATGCCACTACTCCTAGATATGACGAGTTTAAAAGGATCTACCACCTT
TTCCTTTTCCATGCACACCCATTCTGGCTCCAACTGCTGTACTTCCTCTTCATCTCCCTC
TTGGGTTTCTTGATGCTGAAAGCTCTGCCGATGAAGACCAGCATGGTGCCGAGGCCCATG
GACTTGGACCTGATCTTCACGTCGGTGTCGGCGACGACGGTGTCGAGCATGGTCGCCGTC
GAGATGGAGTCCTTCTCCAACTCCCAGCTCCTCCTCATCACCCTCCTCATGCTGCTTGGT
GGTGAGGTCTTCACCAGCATCCTTGGCCTCTACTTCACCAACGCCAAGTACTCCTCCAAG
ATGATAGCAACCTTACCTGATGATGACGACCATGGTGGCAGTGGCAAACCACCACCACCA
ACGACGTCACCTTCGTCTACCCTAGTGGAGCTCGAGCTCGCTCCTCCCATGGACGTCGTC
GTCGTCAACCCTACCACCACTGCGACGACGCACGACGAGGTAGAGCTAGGGTTAGGACGT
CGGAACAAGCGCGGCTGCACCTGCACTACTACTCACACGTCGTCGTCATCATCGGCATCG
AAGACGACGACGACGAGGCTACTGATGTTCGTGGTGATGGGGTACCACGCGGTGGTGCAC
GTCGCCGGGTACACGGCCATCGTCGTGTACCTCAGCGCCGTCGGCGGCGCGGGGGCGGTG
GTCGCCGGGAAGGGGATCAGCGCGCACACGTTCGCCATCTTCACCGTCGTCTCGACGTTC
GCCAACTGCGGGTTCGTGCCGACGAACGAAGGGATGGTGTCGTTCAGGTCGTTCCCGGGG
CTCCTCCTCCTCGTCATGCCGCACGTCCTCCTCGGGAACACGCTCTTCCCGGTCTTCCTC
AGGCTGGCCATCGCCGCGCTCGAGAGGGTCACCGGGTGGCCGGAGCTCGGCGAGCTCCTG
ATCCGGCGGCGGAGGGGCGGCGGCGAGGGCTACCACCACCTGTTGCCGAGCTCGCGCACG
CGGTTCCTGGCCCTCACCGTGGCCGTGCTCGTGGTGGCGCAGCTGGCGCTCTTCTGCGCC
ATGGAGTGGGGCTCCGACGGGCTGCGGGGGCTCACCGCGGGCCAGAAGCTCGTCGGCGCG
CTCTTCATGGCGGTCAACTCGAGGCACTCCGGTGAGATGGTGCTCGACCTCTCCACCGTG
TCGTCGGCCGTCGTCGTGCTCTACGTGGTGATGATGTACCTGCCACCTTACACCACTTTC
GTACCTGTCCAAGACAAACACCAGCAAACGGGAGCACAGTCCGGGCAGGAGGGCAGCAGC
AGCAGCAGCATATGGCAGAAGCTGCTCATGTCGCCGCTCTCGTGCCTAGCCATCTTCATC
GTCGTCATCTGCATCACGGAGCGGCGGCAAATCGCCGACGACCCCATCAACTACAGCGTC
CTCAACATCGTCGTCGAGGTTATCAGTGCGTATGGCAATGTGGGGTTCAGCACGGGGTAC
AGCTGCGCGAGGCAGGTGAGGCCCGACGGCAGCTGCAGAGACCTGTGGGTTGGCTTCTCA
GGGAAGTGGAGCAAACAAGGGAAGCTCACTCTCATGGCCGTCATGTTCTACGGCAGGCTC
AAGAAGTTCAGCCTGCACGGTGGTCAGGCATGGAAGATAGAATAA

Protein

555 aa

>Os01t0307500-01 Na+ transporter, A member of  HKT (high-affinity K+ transporter)-type transporters, Regulation of K+/Na+ homeostasis, Salt tolerance
MSSLDATTPRYDEFKRIYHLFLFHAHPFWLQLLYFLFISLLGFLMLKALPMKTSMVPRPM
DLDLIFTSVSATTVSSMVAVEMESFSNSQLLLITLLMLLGGEVFTSILGLYFTNAKYSSK
MIATLPDDDDHGGSGKPPPPTTSPSSTLVELELAPPMDVVVVNPTTTATTHDEVELGLGR
RNKRGCTCTTTHTSSSSSASKTTTTRLLMFVVMGYHAVVHVAGYTAIVVYLSAVGGAGAV
VAGKGISAHTFAIFTVVSTFANCGFVPTNEGMVSFRSFPGLLLLVMPHVLLGNTLFPVFL
RLAIAALERVTGWPELGELLIRRRRGGGEGYHHLLPSSRTRFLALTVAVLVVAQLALFCA
MEWGSDGLRGLTAGQKLVGALFMAVNSRHSGEMVLDLSTVSSAVVVLYVVMMYLPPYTTF
VPVQDKHQQTGAQSGQEGSSSSSIWQKLLMSPLSCLAIFIVVICITERRQIADDPINYSV
LNIVVEVISAYGNVGFSTGYSCARQVRPDGSCRDLWVGFSGKWSKQGKLTLMAVMFYGRL
KKFSLHGGQAWKIE*

5'UTR

chr01:11463276..11463442 (- strand) : 167 bp

CDS

chr01:11462041..11463275 (- strand) : 1235 bp

chr01:11460163..11460393 (- strand) : 231 bp

chr01:11459287..11459485 (- strand) : 199 bp

3'UTR

chr01:11458956..11459286 (- strand) : 331 bp

FASTA

>Os01t0307500-01 class=Sequence position=chr01:11458956..11463442 (- strand)
GCTGTTGCTC TTGTTCACTT GTGCTCACAG CACCTGGTAA CCCCACATAC AGTGATCACA CAACAAACAA TATCTGTTGT
TTGTGTATAA ATAGCCCTAA CATGGCTTCC TAATTCCTAT AAACAACAAG TGTGAGAAAA CCCAAGAACG AAACACATAG
GAGAGAAATG AGTTCTCTGG ATGCCACTAC TCCTAGATAT GACGAGTTTA AAAGGATCTA CCACCTTTTC CTTTTCCATG
CACACCCATT CTGGCTCCAA CTGCTGTACT TCCTCTTCAT CTCCCTCTTG GGTTTCTTGA TGCTGAAAGC TCTGCCGATG
AAGACCAGCA TGGTGCCGAG GCCCATGGAC TTGGACCTGA TCTTCACGTC GGTGTCGGCG ACGACGGTGT CGAGCATGGT
CGCCGTCGAG ATGGAGTCCT TCTCCAACTC CCAGCTCCTC CTCATCACCC TCCTCATGCT GCTTGGTGGT GAGGTCTTCA
CCAGCATCCT TGGCCTCTAC TTCACCAACG CCAAGTACTC CTCCAAGATG ATAGCAACCT TACCTGATGA TGACGACCAT
GGTGGCAGTG GCAAACCACC ACCACCAACG ACGTCACCTT CGTCTACCCT AGTGGAGCTC GAGCTCGCTC CTCCCATGGA
CGTCGTCGTC GTCAACCCTA CCACCACTGC GACGACGCAC GACGAGGTAG AGCTAGGGTT AGGACGTCGG AACAAGCGCG
GCTGCACCTG CACTACTACT CACACGTCGT CGTCATCATC GGCATCGAAG ACGACGACGA CGAGGCTACT GATGTTCGTG
GTGATGGGGT ACCACGCGGT GGTGCACGTC GCCGGGTACA CGGCCATCGT CGTGTACCTC AGCGCCGTCG GCGGCGCGGG
GGCGGTGGTC GCCGGGAAGG GGATCAGCGC GCACACGTTC GCCATCTTCA CCGTCGTCTC GACGTTCGCC AACTGCGGGT
TCGTGCCGAC GAACGAAGGG ATGGTGTCGT TCAGGTCGTT CCCGGGGCTC CTCCTCCTCG TCATGCCGCA CGTCCTCCTC
GGGAACACGC TCTTCCCGGT CTTCCTCAGG CTGGCCATCG CCGCGCTCGA GAGGGTCACC GGGTGGCCGG AGCTCGGCGA
GCTCCTGATC CGGCGGCGGA GGGGCGGCGG CGAGGGCTAC CACCACCTGT TGCCGAGCTC GCGCACGCGG TTCCTGGCCC
TCACCGTGGC CGTGCTCGTG GTGGCGCAGC TGGCGCTCTT CTGCGCCATG GAGTGGGGCT CCGACGGGCT GCGGGGGCTC
ACCGCGGGCC AGAAGCTCGT CGGCGCGCTC TTCATGGCGG TCAACTCGAG GCACTCCGGT GAGATGGTGC TCGACCTCTC
CACCGTGTCG TCGGCCGTCG TCGTGCTCTA CGTGGTGATG ATGTATGTAT ATTTGTCCTC CTCAATTATT ATATTTTTGA
CAGGCCCTCC TTAATATATT AATTACTATC ACATGCATGT GTGCACACGT AAAAACTAAA TAAATTACCA TATCATACAT
GTGGGTACTT AATTTAGTAC TCTGGCCTGG GACATATTTT AAATCCTATT GGACATCTCC TTTCAAtttt ttttttgaaa
caaagtaaaa acgcaggcgc ttataacgcg tgcacactca cccttatgaa tacaaatctt acccctataa gtaccttcga
aagactgagc tgacatatct tgagattgac gaagtcatca cgggtatctc actgtcaaca agtacatcac tacctaccac
taaaagaata attagccata aatacaagca cccgtgtcaa atttattatt tgaaTCTTTC ATTCTAATTA TATGCGATCA
AAATAGTTAT GAAAAATTCT ACTTTATATG GGGGTGCAGG GTCTCGAGGC ATCTAAATAG TTATGAAAAA ATCTATAAAA
ATATAAGAGA TATATGGTCT TCGATGCTGT GGCACAAGTG GACTAGTGGT TGTCATTTTA CGCGCTCAAA ATGTAACCGA
ACGAGGCGCC GTCATGGATC ACTATCAAAA GCAGCTTAGT ACCGAATTAA CATATGTGGC TACAAATGCT AATCAGCTAA
ATGATAGGAA AGATTGATTG CTACTGATAG ACATGGATTG ACGCTTTCAG TTTGTTGGAG CCCTTGATTT GGCACTTTCA
CGACGATAAT CCGCAAGGAT AATTCTCCAA GTCATATTTT GCAACAAAAT ACAACTACAT CTAGTTTAAT TTCCTCTAAG
TTAGTAAGTT GTGACTGCAA ATTAACAAGT GTATTGATGT CCGAAACCTA GCTAGATGAA GGTTATGTAC ATTGGATAGG
GATCGAAAGA AAATAGACAG AAACAGAGAA CGATAAGTCA ACTGCAAGCA CATActccct tcatactcat aaaggaagtc
gtttaagaca atgtttaagt caaaccttga gattataaat cataaataac tctcaagttg ttgagtttga aaatgtaaaa
attatatgaa taaatttgtc ttgaaaaata ctttcataaa agtatacata tatcactttt caatgaatat ttttatagaa
agaagaagtc aaagttgtat tttggagacc gtgtcgatgt cctaaacgac tttctttatg aggatggagg gagTATATAT
ACTCTgtact taagtatacg ataatgttat ctttgttcag tgaaactttt ggaactttga ttgttactag ctatcaaaat
gtttagtttg agaatataaa aattattaat attataattt tgttagatat tatcgttatg ttttaataaa acaacggtgg
tcaaagtagt ACACACCAAA CACCGAATGA AGTCAACATC GGTGTGTGTA TATATATACG CGGAGGTAGT ACATGGTACA
ACTTTTGAAT TAAACTCCCG AAAAACATAT GTTCTCATGC ATGCTTTTGT ATACAGATAT GATATAGCTC TAAATTAATA
ACTTGCATGA CGGAAATTGA ACATATTTGC TACACTGAAT TATACTGCGT GAACCTTAAT TTGCTTATAT ATTCTCATGC
TTGCTGCAGG TACCTGCCAC CTTACACCAC TTTCGTACCT GTCCAAGACA AACACCAGCA AACGGGAGCA CAGTCCGGGC
AGGAGGGCAG CAGCAGCAGC AGCATATGGC AGAAGCTGCT CATGTCGCCG CTCTCGTGCC TAGCCATCTT CATCGTCGTC
ATCTGCATCA CGGAGCGGCG GCAAATCGCC GACGACCCCA TCAACTACAG CGTCCTCAAC ATCGTCGTCG AGGTTATCAG
GTACGCATAG TGGTGGTCTA ACCTTAATTT TAACTGCTGG CAAGTGCCAA AAAATtactc tctccatctc taaatatttg
acgccgttga ctttttaaaa cattttgacc gttcgtctta tcaaaatttt taagtaatta ttaattcttt tcctatcatt
tgatttatta ctaaatatat ttttatgtat acatataatt ttacatattt ctcaaaagtt tttgaataag acgaacggtt
aaacatgttt aaaaaagtca acaacgtcaa atatttaggg acagagagta Tatttccccc ttgagggtac atacatttct
cctcgttttt atatgtcatc ccaaaaatta caaaagaaaa tctaaaagtt attgataaaa tggacatgtg atatattact
acactaatat atacacgttc aaatataact tgaacacatg ttagaaaaac acaataaatt taactataaa tggcatgttc
aattcgcaat taaatttaat attttatttc tgtttgaaca aattgaatat catatattta aaAAGAGATT AATTAATGAT
TTTTTAAACG AATGGATAAA ATAAGAGAAA GTGAGGAAAA TCCACATCCA CGGAGATAAT ATATATAACT AGAACCATCG
TGTAAACTAA CTATATGTTA CATACTCCTG GATGCAGTGC GTATGGCAAT GTGGGGTTCA GCACGGGGTA CAGCTGCGCG
AGGCAGGTGA GGCCCGACGG CAGCTGCAGA GACCTGTGGG TTGGCTTCTC AGGGAAGTGG AGCAAACAAG GGAAGCTCAC
TCTCATGGCC GTCATGTTCT ACGGCAGGCT CAAGAAGTTC AGCCTGCACG GTGGTCAGGC ATGGAAGATA GAATAACGCC
TAACTGCAAG CACCCATGCA TGCATGACAA CTTCGTTACT AATTAATGGG GCATTTCAGC CGGCCGCCGT ACTAGACTAC
AAGAGATCGA TCGATAGGTC TCCCCTCCTA AAACTCCTCC TTAATCTGAT CTCCACGAGT TCTTGATCAG GGTTACTTAT
ATATTATAAA GGAATGATCA GATAAATATA TGTCTATATC AGGATCTGGT CGATCTCTAG ATATCTGTCT TTTTTTTTTT
TGGGTAATGC ATGTAAGCAA GTAGCAATTG CTAGACATAT ATATGTGTTA GCTTACGAGA GTATATACTG GCGCTTGAGT
CGTGATG