Os01t0311500-01

Locus

Os01g0311500

Description

Similar to PHS1 (PROPYZAMIDE-HYPERSENSITIVE 1); phosphoprotein phosphatase/ protein tyrosine/serine/threonine phosphatase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsPHS1a, OsPP3

Oryzabase Gene Name Synonym(s)

Protein phosphatase 3

Transcript Evidence

AK103288 (DDBJ, Best hit)

Protein Evidence

NP_001031933.1 (RefSeq)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: protein dephosphorylation (GO:0006470)

Biological Process: dephosphorylation (GO:0016311)

Molecular Function: protein tyrosine phosphatase activity (GO:0004725)

Molecular Function: protein tyrosine/serine/threonine phosphatase activity (GO:0008138)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Molecular Function: phosphotransferase activity, alcohol group as acceptor (GO:0016773)

Molecular Function: phosphatase activity (GO:0016791)

Functional domain (InterPro)

Dual specificity phosphatase, catalytic domain (IPR000340)

Protein-tyrosine/Dual-specificity phosphatase (IPR000387)

Phosphatidylinositol 3-/4-kinase, catalytic (IPR000403)

Protein kinase-like domain (IPR011009)

Actin-fragmin kinase, catalytic (IPR015275)

Protein-tyrosine phosphatase, active site (IPR016130)

Dual specificity phosphatase, subgroup, catalytic domain (IPR020422)

Full-length cDNA

J033124N21 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0311500-01)

Others

Oryzabase (10265)

Transcript

3343 bp

>Os01t0311500-01 Similar to PHS1 (PROPYZAMIDE-HYPERSENSITIVE 1); phosphoprotein phosphatase/ protein tyrosine/serine/threonine phosphatase.
CAGTTTGTTCAGCAACTGCCCCCTTCTCTTCCGACTGCACTGATCCGCCCGCCCTTCTCT
CGCTCTGCTTTCGTCTCCCCCCACTGGCCACTCTCTCCCCATTTGCGGGAAAAGCCGACA
CCTAGACGGAAAGGGCGGAGCGGCGAAGAGAGGGGAGGAGGGATCCCGCCTTTTCCGTCG
GATTTGACGGCCCCCCGCGCTCTCCCTCTCTCTGTCTCTCTCTCTCCGGGAGCGAGCCAG
CCAGCAGCAAAAGCCGACCACCACCATCGCCACGCACCCAGTATATCACACCGCGCGCCT
GGGGTCGTCAACGGCTACCTGCGCCGCGGCCCCCTCCCATGGAACAGCGGGAGGCGCGGC
AAGAGGAGGAGGAGGAGGAGGAGCGCGACGCGCCGGCGGTTCCTCCCGGGGAAAACGACG
AGGAAAGAGATCGAAACCTATCCTCTCGTGTGGTTTCTTTGTTATTTGGTGGTGATATCT
CAGCGCAGACATTCGAGAAATGGGTATCATTGGTACGTAAACGAAGTGGGGCATTCCGGC
CATCAGGGTTCCCACGCCGGAATTCGAGGATTGAAGTCATGCCGAGTGGGAGTTTCTCAC
TTTTCAGTGCAGCAGACTTAAGTGAGCAAGTGGTTACAGCAGAGCTAATAGGCAAAGAAG
ATATACCATTGACAAGCAGTCAGCCTACAGAAATAAGTTTGTGGGAGAGACTTGGAAATG
CTTCTGCACTAGATATTGAATCACCTGACTTTTCATGGAATATGCTGTCATCTCTGCACC
ATACAGAGCATAGTAGTAGTTCGGACCACTCTGAAGATGAAATGTGCAAACCTCTTGAGG
TGACTGTGAACTCTGGTGGTGTAGTGTTCTTTGCTCTATTTAATTCTTCAAGTAATGTCT
TACCAAAAGAAGCAGCTGCTGTTATAAAGTTCTCATCATCAAAGATGTCAACTCAGGCAG
AACGGTTGGGTTATGAATTTGCTAGATTGCTTGGAGTTCAGACACCACAAGCTAGAGTGG
TACACAATTCTAGCCTAGAGTGGCAGGATATTAGAAAGGCTGCAGAAAATGCACGATCAG
TAGCAGTTTCAAATAGTGATGAGGTTGGTGAGATGACATGCTCAGAATTGTTGGAAGCTC
TTGAGCTAAGCCGTTGTCTTCTTCTAATGAGTTATATTCATGGATCTCCCCTTCTTGAGA
GTTCAAAGGCATTTAGTCCACGGGAAGCTGCTTGCGTTACTGCTTCATCATTGGGTAGGG
TCTTGATGCTAGATCTGATACTCAGAAATGAGGACAGACTCCCATGCCGTCAGCTTGGTT
GGCGTGGCAATCCTGCAAACCTGATGATTTCCGATAGACCTTCTGCACCCAGTGTGGACA
GATTGGATGATTCCAAGTGCACTACAGAAAGTTCTATTCCAACGATTACTCAATTGGTGC
AGAGTGACAAGCGGACTCACACTGCAAATGCAACCATAAATTCTCCAGAATTGGTGTCCA
TGTCACCAAAACCAGATGCATTGAAAAGTGTAAGAGGAAATGCTGATAGTTTGGATGGCC
CTGTCCACATTGTAGCAATCGACACTGGAGTGCCACGTCGCCCCCCTGCAGGGAGACGGG
TGAAAGATCATGAGCGTTATCCCAAAGTTGTGCAGCTTATGTTGAATAATTCAGATTACT
CCTCGAATATATTGTATGAGATTTCTGGTGGTAAGCTAGGGACTCCAGGACCTGATGAAG
CAATCGCTTTCACTGATTCTTGTTGTTCCATTTCTGATGAAGACAATACTGCTGCGATTC
ATGAATTCCGAGGGGCATTTCGTGCAGCTCTGAGGGATCTTGAGGGGTTCCATCTATTTC
TTCTCCAGCTATACCAAAAACTAGATGGTGTTTTGCGAGTTTTCTTGTCCATAGTTACTA
AAGGCTCTGAAGAATCCGACAACAATGATGCTACAGTTCCTGATTTTCCATCACCCGGTG
CTAACTACAGTACTCCTTGCGCTCCTAGTAAGCAGCAGAATAGTGAATTGCACGGTGATT
CTGAAATACTGAAATCAACGACAAAGCCTTCTTCTGCGGGATCCCGTGGAAGCTCAGACT
CAGTATCTCCTCTGTCCAGGGAGAGTTGGAGTAATAAGTATTTCAAAGGGAGTGCAGAGG
GTCCCCGAAGTTTAAGAATGACAATGAAGCTCCGTGATTTTTACAAGACTCCGAAGGTTG
ATCCTGAATTAGTCAAAGAAATAGAACAATGGAATGAGGCGCTTAAGTCTGATGTGATCA
AATTTTGCGAGGAGAACAATTTTCATTCTGGATTTTTTGATGGCAATGAGAATAACATGG
TAGCTGATGCATATGAATTGAAGGTGCGTCTAGAACACATCATTGAAAGGATAGCCTTGG
TCTCTGACGCTGCAAATACCGAGCGACCTTCTCTTGTTATCAACAACTTGTTCATAGGTG
GGGCTCTGGCTGCAAGATCTATGTACACCCTTCAGCATCTGGGCATTACCCATATACTAT
GTTTGTGTTCAAATGAGATTGGTCAATCTGATTCCCAATTTCCCGATCTTTTTGAATACA
AGAACTTTTCAATTAGTGATGATGATGATGCAAATATCAGTGATCTTTTTGAAGAAGCCT
CAGATTACTTCGATCATGTAGATCATGTTGGAGGCAAGGTTCTTGTTCATTGCTTTGAAG
GAAAAAGTCGGAGTGCCACAATTGTGCTTGCCTACCTGATGCTCAGAAAGGGCCTCACTC
TTGCGAAAGCTTGGAACTTACTGAAGAAAGTGCATCGTCGGGCACAACCGAATGACGGTT
TCGCAAAGGCTCTGCTAGCGCTTGACAGGAAGCTGCATGGAAAGGTGTCTATGGATTGGC
AGCACAAGCGACCTGAGATGAAGGTGTGCCCAATCTGCAGCAAGAACGTCGGACTGAGCA
CGAGCTCACTCAAACTGCATCTGCAGAAGGCTCACAAGCGGCTATCTGCAGGTAGTGTGG
ACAGCGCCATGACCTTGGAGATTCAGAAGTCGATCCAGTCGCTCCGGATCAGCCGCGGTG
GGAGCCTGAGCCCTTCTCAGAAGCTTACCAAGGCGTTCGCTGATGAGCTCAGCTTCTGAA
TCTGTTCTTAGTAGTTTTTTTTTTCTCTCTCGAGGATGCTAGTGTTGTGGCAGTGTGGTG
ATGTGCACGGTACACGTTTTCAAACCGATGTAATTTAGCGGTAGATGTATCAAGCAGACC
GAACTTTAGGTGTGGACAGAATAGGTGTGATACAAGGAAATGTTCACTTTTAACTGTATA
CAACCAGTTTATTAGCAGGAGAACGTTTAGGTTTTGTAATACC

CDS

2781 bp

>Os01t0311500-01 Similar to PHS1 (PROPYZAMIDE-HYPERSENSITIVE 1); phosphoprotein phosphatase/ protein tyrosine/serine/threonine phosphatase.
ATGGAACAGCGGGAGGCGCGGCAAGAGGAGGAGGAGGAGGAGGAGCGCGACGCGCCGGCG
GTTCCTCCCGGGGAAAACGACGAGGAAAGAGATCGAAACCTATCCTCTCGTGTGGTTTCT
TTGTTATTTGGTGGTGATATCTCAGCGCAGACATTCGAGAAATGGGTATCATTGGTACGT
AAACGAAGTGGGGCATTCCGGCCATCAGGGTTCCCACGCCGGAATTCGAGGATTGAAGTC
ATGCCGAGTGGGAGTTTCTCACTTTTCAGTGCAGCAGACTTAAGTGAGCAAGTGGTTACA
GCAGAGCTAATAGGCAAAGAAGATATACCATTGACAAGCAGTCAGCCTACAGAAATAAGT
TTGTGGGAGAGACTTGGAAATGCTTCTGCACTAGATATTGAATCACCTGACTTTTCATGG
AATATGCTGTCATCTCTGCACCATACAGAGCATAGTAGTAGTTCGGACCACTCTGAAGAT
GAAATGTGCAAACCTCTTGAGGTGACTGTGAACTCTGGTGGTGTAGTGTTCTTTGCTCTA
TTTAATTCTTCAAGTAATGTCTTACCAAAAGAAGCAGCTGCTGTTATAAAGTTCTCATCA
TCAAAGATGTCAACTCAGGCAGAACGGTTGGGTTATGAATTTGCTAGATTGCTTGGAGTT
CAGACACCACAAGCTAGAGTGGTACACAATTCTAGCCTAGAGTGGCAGGATATTAGAAAG
GCTGCAGAAAATGCACGATCAGTAGCAGTTTCAAATAGTGATGAGGTTGGTGAGATGACA
TGCTCAGAATTGTTGGAAGCTCTTGAGCTAAGCCGTTGTCTTCTTCTAATGAGTTATATT
CATGGATCTCCCCTTCTTGAGAGTTCAAAGGCATTTAGTCCACGGGAAGCTGCTTGCGTT
ACTGCTTCATCATTGGGTAGGGTCTTGATGCTAGATCTGATACTCAGAAATGAGGACAGA
CTCCCATGCCGTCAGCTTGGTTGGCGTGGCAATCCTGCAAACCTGATGATTTCCGATAGA
CCTTCTGCACCCAGTGTGGACAGATTGGATGATTCCAAGTGCACTACAGAAAGTTCTATT
CCAACGATTACTCAATTGGTGCAGAGTGACAAGCGGACTCACACTGCAAATGCAACCATA
AATTCTCCAGAATTGGTGTCCATGTCACCAAAACCAGATGCATTGAAAAGTGTAAGAGGA
AATGCTGATAGTTTGGATGGCCCTGTCCACATTGTAGCAATCGACACTGGAGTGCCACGT
CGCCCCCCTGCAGGGAGACGGGTGAAAGATCATGAGCGTTATCCCAAAGTTGTGCAGCTT
ATGTTGAATAATTCAGATTACTCCTCGAATATATTGTATGAGATTTCTGGTGGTAAGCTA
GGGACTCCAGGACCTGATGAAGCAATCGCTTTCACTGATTCTTGTTGTTCCATTTCTGAT
GAAGACAATACTGCTGCGATTCATGAATTCCGAGGGGCATTTCGTGCAGCTCTGAGGGAT
CTTGAGGGGTTCCATCTATTTCTTCTCCAGCTATACCAAAAACTAGATGGTGTTTTGCGA
GTTTTCTTGTCCATAGTTACTAAAGGCTCTGAAGAATCCGACAACAATGATGCTACAGTT
CCTGATTTTCCATCACCCGGTGCTAACTACAGTACTCCTTGCGCTCCTAGTAAGCAGCAG
AATAGTGAATTGCACGGTGATTCTGAAATACTGAAATCAACGACAAAGCCTTCTTCTGCG
GGATCCCGTGGAAGCTCAGACTCAGTATCTCCTCTGTCCAGGGAGAGTTGGAGTAATAAG
TATTTCAAAGGGAGTGCAGAGGGTCCCCGAAGTTTAAGAATGACAATGAAGCTCCGTGAT
TTTTACAAGACTCCGAAGGTTGATCCTGAATTAGTCAAAGAAATAGAACAATGGAATGAG
GCGCTTAAGTCTGATGTGATCAAATTTTGCGAGGAGAACAATTTTCATTCTGGATTTTTT
GATGGCAATGAGAATAACATGGTAGCTGATGCATATGAATTGAAGGTGCGTCTAGAACAC
ATCATTGAAAGGATAGCCTTGGTCTCTGACGCTGCAAATACCGAGCGACCTTCTCTTGTT
ATCAACAACTTGTTCATAGGTGGGGCTCTGGCTGCAAGATCTATGTACACCCTTCAGCAT
CTGGGCATTACCCATATACTATGTTTGTGTTCAAATGAGATTGGTCAATCTGATTCCCAA
TTTCCCGATCTTTTTGAATACAAGAACTTTTCAATTAGTGATGATGATGATGCAAATATC
AGTGATCTTTTTGAAGAAGCCTCAGATTACTTCGATCATGTAGATCATGTTGGAGGCAAG
GTTCTTGTTCATTGCTTTGAAGGAAAAAGTCGGAGTGCCACAATTGTGCTTGCCTACCTG
ATGCTCAGAAAGGGCCTCACTCTTGCGAAAGCTTGGAACTTACTGAAGAAAGTGCATCGT
CGGGCACAACCGAATGACGGTTTCGCAAAGGCTCTGCTAGCGCTTGACAGGAAGCTGCAT
GGAAAGGTGTCTATGGATTGGCAGCACAAGCGACCTGAGATGAAGGTGTGCCCAATCTGC
AGCAAGAACGTCGGACTGAGCACGAGCTCACTCAAACTGCATCTGCAGAAGGCTCACAAG
CGGCTATCTGCAGGTAGTGTGGACAGCGCCATGACCTTGGAGATTCAGAAGTCGATCCAG
TCGCTCCGGATCAGCCGCGGTGGGAGCCTGAGCCCTTCTCAGAAGCTTACCAAGGCGTTC
GCTGATGAGCTCAGCTTCTGA

Protein

927 aa

>Os01t0311500-01 Similar to PHS1 (PROPYZAMIDE-HYPERSENSITIVE 1); phosphoprotein phosphatase/ protein tyrosine/serine/threonine phosphatase.
MEQREARQEEEEEEERDAPAVPPGENDEERDRNLSSRVVSLLFGGDISAQTFEKWVSLVR
KRSGAFRPSGFPRRNSRIEVMPSGSFSLFSAADLSEQVVTAELIGKEDIPLTSSQPTEIS
LWERLGNASALDIESPDFSWNMLSSLHHTEHSSSSDHSEDEMCKPLEVTVNSGGVVFFAL
FNSSSNVLPKEAAAVIKFSSSKMSTQAERLGYEFARLLGVQTPQARVVHNSSLEWQDIRK
AAENARSVAVSNSDEVGEMTCSELLEALELSRCLLLMSYIHGSPLLESSKAFSPREAACV
TASSLGRVLMLDLILRNEDRLPCRQLGWRGNPANLMISDRPSAPSVDRLDDSKCTTESSI
PTITQLVQSDKRTHTANATINSPELVSMSPKPDALKSVRGNADSLDGPVHIVAIDTGVPR
RPPAGRRVKDHERYPKVVQLMLNNSDYSSNILYEISGGKLGTPGPDEAIAFTDSCCSISD
EDNTAAIHEFRGAFRAALRDLEGFHLFLLQLYQKLDGVLRVFLSIVTKGSEESDNNDATV
PDFPSPGANYSTPCAPSKQQNSELHGDSEILKSTTKPSSAGSRGSSDSVSPLSRESWSNK
YFKGSAEGPRSLRMTMKLRDFYKTPKVDPELVKEIEQWNEALKSDVIKFCEENNFHSGFF
DGNENNMVADAYELKVRLEHIIERIALVSDAANTERPSLVINNLFIGGALAARSMYTLQH
LGITHILCLCSNEIGQSDSQFPDLFEYKNFSISDDDDANISDLFEEASDYFDHVDHVGGK
VLVHCFEGKSRSATIVLAYLMLRKGLTLAKAWNLLKKVHRRAQPNDGFAKALLALDRKLH
GKVSMDWQHKRPEMKVCPICSKNVGLSTSSLKLHLQKAHKRLSAGSVDSAMTLEIQKSIQ
SLRISRGGSLSPSQKLTKAFADELSF*

5'UTR

chr01:11693812..11694149 (+ strand) : 338 bp

CDS

chr01:11694150..11694221 (+ strand) : 72 bp

chr01:11695113..11695151 (+ strand) : 39 bp

chr01:11695290..11695462 (+ strand) : 173 bp

chr01:11696189..11696405 (+ strand) : 217 bp

chr01:11696639..11696809 (+ strand) : 171 bp

chr01:11696902..11697062 (+ strand) : 161 bp

chr01:11697146..11698190 (+ strand) : 1045 bp

chr01:11698441..11698587 (+ strand) : 147 bp

chr01:11698668..11698895 (+ strand) : 228 bp

chr01:11698984..11699141 (+ strand) : 158 bp

chr01:11699245..11699614 (+ strand) : 370 bp

3'UTR

chr01:11699615..11699838 (+ strand) : 224 bp

FASTA

>Os01t0311500-01 class=Sequence position=chr01:11693812..11699838 (+ strand)
CAGTTTGTTC AGCAACTGCC CCCTTCTCTT CCGACTGCAC TGATCCGCCC GCCCTTCTCT CGCTCTGCTT TCGTCTCCCC
CCACTGGCCA CTCTCTCCCC ATTTGCGGGA AAAGCCGACA CCTAGACGGA AAGGGCGGAG CGGCGAAGAG AGGGGAGGAG
GGATCCCGCC TTTTCCGTCG GATTTGACGG CCCCCCGCGC TCTCCCTCTC TCTGTCTCTC TCTCTCCGGG AGCGAGCCAG
CCAGCAGCAA AAGCCGACCA CCACCATCGC CACGCACCCA GTATATCACA CCGCGCGCCT GGGGTCGTCA ACGGCTACCT
GCGCCGCGGC CCCCTCCCAT GGAACAGCGG GAGGCGCGGC AAGAGGAGGA GGAGGAGGAG GAGCGCGACG CGCCGGCGGT
TCCTCCCGGG GTGAGCCGAG CTCCATTTCC TCTTTTCCTG CTCGGTGCTG TGTGATCTGA TCTGATCTGG GTTGTGACGC
TTCGGTGCGG TGGCTCTTGG ATTGGTGGCG AGCGGAGGCC GGAGGGTTTG GGGGGCGTAG AGTGAGGGCG CATGTCCCGA
TGTCCGGGAG GGATCTCGAT CTGCCTCGGC GTCTCGGTTG GCGTTGGCTA ATCTGCGTGG CGAGGTGGCG TGCGGAGATG
AAATGCGCTA GTAGTTTTGT TTTTTTTGGG GGGCAGATTT GCACTGCGTT GATTGAGAAT CTTGCGATTC AGGCTGATGT
GGTCCTCGTT CTTGCGCAAA ATGCACCTTC TTTGATGAGA GGCGCAGCAA CTTTTTGCTT CGTGCGATTC ATTGGGGGGA
TATATTCCGC TTGGTACCCC CTGATCAAAT CAATCCTAGC ATTCTGTTGT ACCTTCTGTT CAATCATGGG TAACATTTTT
AAATGCTTGA TCTCCTGATT CAATCAATGT TAGCATTCGG TTTTACTTAA AGTCTGTAGC TTCTGGCTCT GATAGAAAAG
TCGCAGTTTG GCAGGACATG TGCCAAATTC AAGGGAACTT TTCATTGTAA GTAAGACATT AATTTTATCA TTCCTCAAAC
CCATGCCGTT CAGAAGGTGC CAAAGCAATA GTGTTTTTCG TGTTAATAAT GAATTCATCA TGATTGCACT GCGTAGGTTG
AGAATCTTGA CAAGCTGATG TCCAAATTTT CGGTCTAGTT CAACTTAGAA AGTACCTTTG TATTTTTTGT CTCCTCTTGC
CATCAAAACC ATAACCTGTG AATGGAACAC GCTATCAGTG TGTTTTAACT ATTTATTTCT GCATGAAACA AGAACATATA
AGAGTTTTAC ATTTCTTGCA GGAAAACGAC GAGGAAAGAG ATCGAAACCT ATCCTCTCGT GTAAGTGTCA ATTTGTCTAA
TTTCCTGTTG CCAGTTCTAT TGTGTTGCTC ATGTACATTT CCATACCGAA TATAACCTCA GAAGCCCGGG TTACGGATCT
ACTGGATATC TTTTCTAAAT TCCTGCTTGT GTTTGTAGGT GGTTTCTTTG TTATTTGGTG GTGATATCTC AGCGCAGACA
TTCGAGAAAT GGGTATCATT GGTACGTAAA CGAAGTGGGG CATTCCGGCC ATCAGGGTTC CCACGCCGGA ATTCGAGGAT
TGAAGTCATG CCGAGTGGGA GTTTCTCACT TTTCAGTGCA GCAGACTTAA GGTAGCTTAG CAAAATATAT CAACAATCAC
TTGGAATTAT TTGTGGAGTA GCACCTAATC GATTATCTGC AGTTAGTAGA TTAAATTGTC TCATAATCAT CTTATTAGGC
ATAACGTGCA CTGCAGCGAA CCTTCTCATA TAAATGTTGA TTACGTTCTA GTATACTTCA TCTGAAAAGT CAAAGGACTA
GCAAATATGT TGTGGACATA TCTGTGATAC AAGATTGAGT CTACTTTCCA GATTTCTCCA GTAGGAAGTT AATTGTCCAC
ATCCATTGCA GTTGGCCACA TTCTGTTTGT AATCCAAGAT CGCATGAACA CTTTTTCTTA GAGTTTTCAA TTAAAACTGT
CATAATAAAC ATTGATTAGG CATGATATGT AATATGCATA TACTGTGCCT AGCAAATATT AATTCAATAT GATATGTAAC
ATTATACATT TATCAGTGAA CATAGAAAAC TATCCGTTAA AAGGTAGCAT CCTTGTGCTT TACAAATTAC CAGTTACATA
TGATGGCATC CTGTACTTTT TTATTGGTTA TTATAATAAT TTAGATTTAC ATTTCTAAAT GGGAACTTGG ATAGAAATAT
GAGTATGTAT TAATTGCAAT ATTTGTCGGT TTACTTTAAC TCCAGATGAC ATGCAATTTG GTAAATAATA AATGTTGACC
TGGCCTTGTA AGTATGTTGA GCTAATGCTA TTATTGTTTT GCAACTGCCC ACTATAGTGA GCAAGTGGTT ACAGCAGAGC
TAATAGGCAA AGAAGATATA CCATTGACAA GCAGTCAGCC TACAGAAATA AGTTTGTGGG AGAGACTTGG AAATGCTTCT
GCACTAGATA TTGAATCACC TGACTTTTCA TGGAATATGC TGTCATCTCT GCACCATACA GAGCATAGTA GTAGTTCGGA
CCACTCTGAA GATGAAATGT GCAAACCTCT TGAGGTTTGT TGCTGCCTTC TGTTGGCAAT TTTTACATTC TTTTTAGTTA
TTGCAAGAGA AAAATAAACA ATCATTTACT TCCATACTAT ATTACACAAA CATGATTTTT TTAAACATTT TTTAATTTTC
ATATTGGACA TGCAAGACCA TATTTATTTA TCTGATATTC ACTCCATTGG ACCATCTTTA TATTTCCATG CATTTGACAT
GATAGTTTCT GCTTGCTGTC TTTATAGGTG ACTGTGAACT CTGGTGGTGT AGTGTTCTTT GCTCTATTTA ATTCTTCAAG
TAATGTCTTA CCAAAAGAAG CAGCTGCTGT TATAAAGTTC TCATCATCAA AGATGTCAAC TCAGGCAGAA CGGTTGGGTT
ATGAATTTGC TAGATTGCTT GGAGTTCAGA CACCACAAGT ATTTTGCAAA CTCCCAATGA ATTATGCGCA CTTTGATTAT
GATGTACCAC AACATTTGAT TTCTTATTCA GGTTTTTCTA ACAACTGCAG GCTAGAGTGG TACACAATTC TAGCCTAGAG
TGGCAGGATA TTAGAAAGGC TGCAGAAAAT GCACGATCAG TAGCAGTTTC AAATAGTGAT GAGGTTGGTG AGATGACATG
CTCAGAATTG TTGGAAGCTC TTGAGCTAAG CCGTTGTCTT CTTCTAATGA GGTACTACTA TGATTAAATA TGCATTTTCT
TTATGGTAAA CTGCATTTAG GAGGAGATAT AAATTGTTAC TACTGTATTG GCAGTTATAT TCATGGATCT CCCCTTCTTG
AGAGTTCAAA GGCATTTAGT CCACGGGAAG CTGCTTGCGT TACTGCTTCA TCATTGGGTA GGGTCTTGAT GCTAGATCTG
ATACTCAGAA ATGAGGACAG ACTCCCATGC CGTCAGCTTG GTTGGCGTGG CAATCCTGCA AACCTGATGA TTTCCGATAG
ACCTTCTGCA CCCAGTGTGG ACAGATTGGA TGATTCCAAG TGCACTACAG AAAGTTCTAT TCCAACGATT ACTCAATTGG
TGCAGAGTGA CAAGCGGACT CACACTGCAA ATGCAACCAT AAATTCTCCA GAATTGGTGT CCATGTCACC AAAACCAGAT
GCATTGAAAA GTGTAAGAGG AAATGCTGAT AGTTTGGATG GCCCTGTCCA CATTGTAGCA ATCGACACTG GAGTGCCACG
TCGCCCCCCT GCAGGGAGAC GGGTGAAAGA TCATGAGCGT TATCCCAAAG TTGTGCAGCT TATGTTGAAT AATTCAGATT
ACTCCTCGAA TATATTGTAT GAGATTTCTG GTGGTAAGCT AGGGACTCCA GGACCTGATG AAGCAATCGC TTTCACTGAT
TCTTGTTGTT CCATTTCTGA TGAAGACAAT ACTGCTGCGA TTCATGAATT CCGAGGGGCA TTTCGTGCAG CTCTGAGGGA
TCTTGAGGGG TTCCATCTAT TTCTTCTCCA GCTATACCAA AAACTAGATG GTGTTTTGCG AGTTTTCTTG TCCATAGTTA
CTAAAGGCTC TGAAGAATCC GACAACAATG ATGCTACAGT TCCTGATTTT CCATCACCCG GTGCTAACTA CAGTACTCCT
TGCGCTCCTA GTAAGCAGCA GAATAGTGAA TTGCACGGTG ATTCTGAAAT ACTGAAATCA ACGACAAAGC CTTCTTCTGC
GGGATCCCGT GGAAGCTCAG ACTCAGTATC TCCTCTGTCC AGGGAGAGTT GGAGTAATAA GTATTTCAAA GGGAGTGCAG
AGGGTCCCCG AAGTTTAAGA ATGACAATGA AGCTCCGTGA TTTTTACAAG ACTCCGAAGG TAAGAGTTTT CTATTTGCAA
TAAGATTGTT TATCTGATTG CATAACTATG CTCGTTTGTT AAGCAAACTT CAGTTTGGTT AGCCTGTCTT TGTTTTACTG
GACAAAAGTA GTACCAACAT TTAATGCAGC TTGCTTCAGA GTAGTTTCTA TTGAAATGAA TTGCCTAGTT CAACTGACTG
CTGCGTGTGC CGATTGGCCT TTTTTTAGTT TATTCCAAAC TCAGTTGCAA CTACTATTTA TTGTGACAGG TTGATCCTGA
ATTAGTCAAA GAAATAGAAC AATGGAATGA GGCGCTTAAG TCTGATGTGA TCAAATTTTG CGAGGAGAAC AATTTTCATT
CTGGATTTTT TGATGGCAAT GAGAATAACA TGGTAGCTGA TGCATATGAA TTGAAGGTGG GTCCTGATGT ACTGGTATCT
AAATATATAG TACTTCTGTT AAAGAAAAAA TATATTCATA AATTACTAAC TTGCAGGTGC GTCTAGAACA CATCATTGAA
AGGATAGCCT TGGTCTCTGA CGCTGCAAAT ACCGAGCGAC CTTCTCTTGT TATCAACAAC TTGTTCATAG GTGGGGCTCT
GGCTGCAAGA TCTATGTACA CCCTTCAGCA TCTGGGCATT ACCCATATAC TATGTTTGTG TTCAAATGAG ATTGGTCAAT
CTGATTCCCA ATTTCCCGAT CTTTTTGAAT ACAAGAACTT TTCAGTAAGA GCATCAATCA ACCTCTGACA TAGTGCATGT
TCCATGATAC TGAGTTCCAC ACTGAAATCA TTCATCTTGT AATGTTTTAC AGATTAGTGA TGATGATGAT GCAAATATCA
GTGATCTTTT TGAAGAAGCC TCAGATTACT TCGATCATGT AGATCATGTT GGAGGCAAGG TTCTTGTTCA TTGCTTTGAA
GGAAAAAGTC GGAGTGCCAC AATTGTGCTT GCCTACCTGA TGCTCAGAAA GTAAGAAATT TAACTTTGTA ACTAGCAATC
TTCCGTTGGC AAATTATGTG GTAATGTCAC ACAAGAACCT CACCCATGCC TGCTGACAAA ACACTTATTT CAGGGGCCTC
ACTCTTGCGA AAGCTTGGAA CTTACTGAAG AAAGTGCATC GTCGGGCACA ACCGAATGAC GGTTTCGCAA AGGCTCTGCT
AGCGCTTGAC AGGAAGCTGC ATGGAAAGGT GTCTATGGAT TGGCAGCACA AGCGACCTGA GATGAAGGTG TGCCCAATCT
GCAGCAAGAA CGTCGGACTG AGCACGAGCT CACTCAAACT GCATCTGCAG AAGGCTCACA AGCGGCTATC TGCAGGTAGT
GTGGACAGCG CCATGACCTT GGAGATTCAG AAGTCGATCC AGTCGCTCCG GATCAGCCGC GGTGGGAGCC TGAGCCCTTC
TCAGAAGCTT ACCAAGGCGT TCGCTGATGA GCTCAGCTTC TGAATCTGTT CTTAGTAGTT TTTTTTTTCT CTCTCGAGGA
TGCTAGTGTT GTGGCAGTGT GGTGATGTGC ACGGTACACG TTTTCAAACC GATGTAATTT AGCGGTAGAT GTATCAAGCA
GACCGAACTT TAGGTGTGGA CAGAATAGGT GTGATACAAG GAAATGTTCA CTTTTAACTG TATACAACCA GTTTATTAGC
AGGAGAACGT TTAGGTTTTG TAATACC