Os01t0311500-02

Locus

Os01g0311500

Description

Similar to predicted protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsPHS1a, OsPP3

Oryzabase Gene Name Synonym(s)

Protein phosphatase 3

Transcript Evidence

AK062171 (DDBJ, Best hit)

Protein Evidence

NP_001031933.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein dephosphorylation (GO:0006470)

Biological Process: dephosphorylation (GO:0016311)

Molecular Function: protein tyrosine phosphatase activity (GO:0004725)

Molecular Function: protein tyrosine/serine/threonine phosphatase activity (GO:0008138)

Molecular Function: phosphatase activity (GO:0016791)

Functional domain (InterPro)

Dual specificity phosphatase, catalytic domain (IPR000340)

Protein-tyrosine/Dual-specificity phosphatase (IPR000387)

Protein-tyrosine phosphatase, active site (IPR016130)

Dual specificity phosphatase, subgroup, catalytic domain (IPR020422)

Full-length cDNA

001-046-C05 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0311500-02)

RiceXPro (AK062171)

Others

Oryzabase (10265)

KEGG (Os01t0311500-02)

Transcript

1194 bp

>Os01t0311500-02 Similar to predicted protein.
CAAAGGGAGTGCAGAGGGTCCCCGAAGTTTAAGAATGACAATGAAGCTCCGTGATTTTTA
CAAGACTCCGAAGGTTGATCCTGAATTAGTCAAAGAAATAGAACAATGGAATGAGGCGCT
TAAGTCTGATGTGATCAAATTTTGCGAGGAGAACAATTTTCATTCTGGATTTTTTGATGG
CAATGAGAATAACATGGTAGCTGATGCATATGAATTGAAGGTGCGTCTAGAACACATCAT
TGAAAGGATAGCCTTGGTCTCTGACGCTGCAAATACCGAGCGACCTTCTCTTGTTATCAA
CAACTTGTTCATAGGTGGGGCTCTGGCTGCAAGATCTATGTACACCCTTCAGCATCTGGG
CATTACCCATATACTATGTTTGTGTTCAAATGAGATTGGTCAATCTGATTCCCAATTTCC
CGATCTTTTTGAATACAAGAACTTTTCAATTAGTGATGATGATGATGCAAATATCAGTGA
TCTTTTTGAAGAAGCCTCAGATTACTTCGATCATGTAGATCATGTTGGAGGCAAGGTTCT
TGTTCATTGCTTTGAAGGAAAAAGTCGGAGTGCCACAATTGTGCTTGCCTACCTGATGCT
CAGAAAGGGCCTCACTCTTGCGAAAGCTTGGAACTTACTGAAGAAAGTGCATCGTCGGGC
ACAACCGAATGACGGTTTCGCAAAGGCTCTGCTAGCGCTTGACAGGAAGCTGCATGGAAA
GGTGTCTATGGATTGGCAGCACAAGCGACCTGAGATGAAGGTGTGCCCAATCTGCAGCAA
GAACGTCGGACTGAGCACGAGCTCACTCAAACTGCATCTGCAGAAGGCTCACAAGCGGCT
ATCTGCAGGTAGTGTGGACAGCGCCATGACCTTGGAGATTCAGAAGTCGATCCAGTCGCT
CCGGATCAGCCGCGGTGGGAGCCTGAGCCCTTCTCAGAAGCTTACCAAGGCGTTCGCTGA
TGAGCTCAGCTTCTGAATCTGTTCTTAGTAGTTTTTTTTTTCTCTCTCGAGGATGCTAGT
GTTGTGGCAGTGTGGTGATGTGCACGGTACACGTTTTCAAACCGATGTAATTTAGCGGTA
GATGTATCAAGCAGACCGAACTTTAGGTGTGGACAGAATAGGTGTGATACAAGGAAATGT
TCACTTTTAACTGTATACAACCAGTTTATTAGCAGGAGAACGTTTAGGTTTTGT

CDS

975 bp

>Os01t0311500-02 Similar to predicted protein.
AAAGGGAGTGCAGAGGGTCCCCGAAGTTTAAGAATGACAATGAAGCTCCGTGATTTTTAC
AAGACTCCGAAGGTTGATCCTGAATTAGTCAAAGAAATAGAACAATGGAATGAGGCGCTT
AAGTCTGATGTGATCAAATTTTGCGAGGAGAACAATTTTCATTCTGGATTTTTTGATGGC
AATGAGAATAACATGGTAGCTGATGCATATGAATTGAAGGTGCGTCTAGAACACATCATT
GAAAGGATAGCCTTGGTCTCTGACGCTGCAAATACCGAGCGACCTTCTCTTGTTATCAAC
AACTTGTTCATAGGTGGGGCTCTGGCTGCAAGATCTATGTACACCCTTCAGCATCTGGGC
ATTACCCATATACTATGTTTGTGTTCAAATGAGATTGGTCAATCTGATTCCCAATTTCCC
GATCTTTTTGAATACAAGAACTTTTCAATTAGTGATGATGATGATGCAAATATCAGTGAT
CTTTTTGAAGAAGCCTCAGATTACTTCGATCATGTAGATCATGTTGGAGGCAAGGTTCTT
GTTCATTGCTTTGAAGGAAAAAGTCGGAGTGCCACAATTGTGCTTGCCTACCTGATGCTC
AGAAAGGGCCTCACTCTTGCGAAAGCTTGGAACTTACTGAAGAAAGTGCATCGTCGGGCA
CAACCGAATGACGGTTTCGCAAAGGCTCTGCTAGCGCTTGACAGGAAGCTGCATGGAAAG
GTGTCTATGGATTGGCAGCACAAGCGACCTGAGATGAAGGTGTGCCCAATCTGCAGCAAG
AACGTCGGACTGAGCACGAGCTCACTCAAACTGCATCTGCAGAAGGCTCACAAGCGGCTA
TCTGCAGGTAGTGTGGACAGCGCCATGACCTTGGAGATTCAGAAGTCGATCCAGTCGCTC
CGGATCAGCCGCGGTGGGAGCCTGAGCCCTTCTCAGAAGCTTACCAAGGCGTTCGCTGAT
GAGCTCAGCTTCTGA

Protein

325 aa

>Os01t0311500-02 Similar to predicted protein.
KGSAEGPRSLRMTMKLRDFYKTPKVDPELVKEIEQWNEALKSDVIKFCEENNFHSGFFDG
NENNMVADAYELKVRLEHIIERIALVSDAANTERPSLVINNLFIGGALAARSMYTLQHLG
ITHILCLCSNEIGQSDSQFPDLFEYKNFSISDDDDANISDLFEEASDYFDHVDHVGGKVL
VHCFEGKSRSATIVLAYLMLRKGLTLAKAWNLLKKVHRRAQPNDGFAKALLALDRKLHGK
VSMDWQHKRPEMKVCPICSKNVGLSTSSLKLHLQKAHKRLSAGSVDSAMTLEIQKSIQSL
RISRGGSLSPSQKLTKAFADELSF*

5'UTR

chr01:11698118..11698118 (+ strand) : 1 bp

CDS

chr01:11698119..11698190 (+ strand) : 72 bp

chr01:11698441..11698587 (+ strand) : 147 bp

chr01:11698668..11698895 (+ strand) : 228 bp

chr01:11698984..11699141 (+ strand) : 158 bp

chr01:11699245..11699614 (+ strand) : 370 bp

3'UTR

chr01:11699615..11699832 (+ strand) : 218 bp

FASTA

>Os01t0311500-02 class=Sequence position=chr01:11698118..11699832 (+ strand)
CAAAGGGAGT GCAGAGGGTC CCCGAAGTTT AAGAATGACA ATGAAGCTCC GTGATTTTTA CAAGACTCCG AAGGTAAGAG
TTTTCTATTT GCAATAAGAT TGTTTATCTG ATTGCATAAC TATGCTCGTT TGTTAAGCAA ACTTCAGTTT GGTTAGCCTG
TCTTTGTTTT ACTGGACAAA AGTAGTACCA ACATTTAATG CAGCTTGCTT CAGAGTAGTT TCTATTGAAA TGAATTGCCT
AGTTCAACTG ACTGCTGCGT GTGCCGATTG GCCTTTTTTT AGTTTATTCC AAACTCAGTT GCAACTACTA TTTATTGTGA
CAGGTTGATC CTGAATTAGT CAAAGAAATA GAACAATGGA ATGAGGCGCT TAAGTCTGAT GTGATCAAAT TTTGCGAGGA
GAACAATTTT CATTCTGGAT TTTTTGATGG CAATGAGAAT AACATGGTAG CTGATGCATA TGAATTGAAG GTGGGTCCTG
ATGTACTGGT ATCTAAATAT ATAGTACTTC TGTTAAAGAA AAAATATATT CATAAATTAC TAACTTGCAG GTGCGTCTAG
AACACATCAT TGAAAGGATA GCCTTGGTCT CTGACGCTGC AAATACCGAG CGACCTTCTC TTGTTATCAA CAACTTGTTC
ATAGGTGGGG CTCTGGCTGC AAGATCTATG TACACCCTTC AGCATCTGGG CATTACCCAT ATACTATGTT TGTGTTCAAA
TGAGATTGGT CAATCTGATT CCCAATTTCC CGATCTTTTT GAATACAAGA ACTTTTCAGT AAGAGCATCA ATCAACCTCT
GACATAGTGC ATGTTCCATG ATACTGAGTT CCACACTGAA ATCATTCATC TTGTAATGTT TTACAGATTA GTGATGATGA
TGATGCAAAT ATCAGTGATC TTTTTGAAGA AGCCTCAGAT TACTTCGATC ATGTAGATCA TGTTGGAGGC AAGGTTCTTG
TTCATTGCTT TGAAGGAAAA AGTCGGAGTG CCACAATTGT GCTTGCCTAC CTGATGCTCA GAAAGTAAGA AATTTAACTT
TGTAACTAGC AATCTTCCGT TGGCAAATTA TGTGGTAATG TCACACAAGA ACCTCACCCA TGCCTGCTGA CAAAACACTT
ATTTCAGGGG CCTCACTCTT GCGAAAGCTT GGAACTTACT GAAGAAAGTG CATCGTCGGG CACAACCGAA TGACGGTTTC
GCAAAGGCTC TGCTAGCGCT TGACAGGAAG CTGCATGGAA AGGTGTCTAT GGATTGGCAG CACAAGCGAC CTGAGATGAA
GGTGTGCCCA ATCTGCAGCA AGAACGTCGG ACTGAGCACG AGCTCACTCA AACTGCATCT GCAGAAGGCT CACAAGCGGC
TATCTGCAGG TAGTGTGGAC AGCGCCATGA CCTTGGAGAT TCAGAAGTCG ATCCAGTCGC TCCGGATCAG CCGCGGTGGG
AGCCTGAGCC CTTCTCAGAA GCTTACCAAG GCGTTCGCTG ATGAGCTCAG CTTCTGAATC TGTTCTTAGT AGTTTTTTTT
TTCTCTCTCG AGGATGCTAG TGTTGTGGCA GTGTGGTGAT GTGCACGGTA CACGTTTTCA AACCGATGTA ATTTAGCGGT
AGATGTATCA AGCAGACCGA ACTTTAGGTG TGGACAGAAT AGGTGTGATA CAAGGAAATG TTCACTTTTA ACTGTATACA
ACCAGTTTAT TAGCAGGAGA ACGTTTAGGT TTTGT