Os01t0332100-02

Locus

Os01g0332100

Description

Similar to Invertase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

NIN2

CGSNL Gene Name

NEUTRAL/ALKALINE INVERTASE 2

Oryzabase Gene Symbol Synonym(s)

OsNIN2, CytINV, OsCytINV

Oryzabase Gene Name Synonym(s)

neutral/alkaline invertase 2, cytosolic neutral invertase

Transcript Evidence

AK061240 (DDBJ, Best hit)

Protein Evidence

Q84XG8 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: catalytic activity (GO:0003824)

Functional domain (InterPro)

Plant neutral invertase (IPR006937)

Six-hairpin glycosidase-like (IPR008928)

Full-length cDNA

006-211-C06 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0332100-02)

RiceXPro (AK061240)

Others

Oryzabase (14667)

KEGG (Os01t0332100-02)

Transcript

1228 bp

>Os01t0332100-02 Similar to Invertase.
GCTTTGTTCTACTCTGCCCTACGATGCTCACGAGAAATGCTTGTTATGAACGATGGGTCA
AAAAACCTCCTTCGTGCCATTAATAACAGGCTGAGTGCGCTGTCCTTTCATATTAGGGAA
TACTACTGGGTTGACATGAAGAAGATAAATGAGATATACAGATACAAAACAGAAGAATAC
TCTCATGATGCAACAAACAAATTCAACATTTATCCTGAGCAAATCCCTTCTTGGCTTGTT
GACTGGATTCCTGAAAAAGGTGGCTATCTCATCGGGAACCTGCAGCCAGCTCACATGGAT
TTCAGGTTCTTCTCTCTCGGCAACCTTTGGGCAATAACTTCATCTCTAACTACTCCAAAA
CAAGCTGAGGGAATACTTAGCCTTATTGATGAGAAATGGGATGATCTCATAGCAAACATG
CCCCTCAAGATATGTTACCCCGCAATGGAAGATGATGAATGGCGCATTATTACCGGCAGT
GATCCTAAGAACACCCCATGGTCATATCATAATGGTGGATCCTGGCCAACGCTGCTGTGG
CAGTTTACATTGGCCTGTATCAAAATGGGAAGACCAGAGTTGGCCCGAAGAGCCATTGCT
GTGGCCGAGGAGAAGCTGGCAGCTGACAAATGGCCAGAGTACTATGACACCCGCTCTGGA
AGATTCATCGGGAAGCAATCTCGGTCATATCAGACATGGACTATTGCTGGTTTTCTGACC
TCTAAGATGCTATTGGAAAACCCCGAGCTGGCTTCTATTCTGACCTGCGATGAGGACCTC
GAGCTGCTTGAAGGCTGTGCATGCTGCCTTTCTAAGAAGAGAACTAGGTGCTCACGCCGT
GCAGCCAAGTCCCATGTCGTCGAGTAAAACAGCAGAGTCCCTTTTATACATGCTACTCTG
CACGCACAAGTATACTACGAGTACTTGTCGACAATTAACTTGAGACGAACACACTATAGC
CATGTACATTAGTATAGGTTTACACTAGATATCCATCCATTCATTTTCCTCGATGCGCGC
TCATTCGTTTTTGCTGAGCTGCCATCGATGGGATTGGAGCTACCCTGGGTGATACCGGTG
GTCGACGAGAGCAACACCGATTCAGGTCTGTGGCTCTCGTGTACACAGGAAATTGAAGTT
TGTTGTTGTGTTCGGTCCACCAGCAGCTCCTAATTCGGGAGTGCTGCGAAGCCCTAACCA
TTGTATCCATTGTCATTATTTAAGCTGT

CDS

867 bp

>Os01t0332100-02 Similar to Invertase.
GCTTTGTTCTACTCTGCCCTACGATGCTCACGAGAAATGCTTGTTATGAACGATGGGTCA
AAAAACCTCCTTCGTGCCATTAATAACAGGCTGAGTGCGCTGTCCTTTCATATTAGGGAA
TACTACTGGGTTGACATGAAGAAGATAAATGAGATATACAGATACAAAACAGAAGAATAC
TCTCATGATGCAACAAACAAATTCAACATTTATCCTGAGCAAATCCCTTCTTGGCTTGTT
GACTGGATTCCTGAAAAAGGTGGCTATCTCATCGGGAACCTGCAGCCAGCTCACATGGAT
TTCAGGTTCTTCTCTCTCGGCAACCTTTGGGCAATAACTTCATCTCTAACTACTCCAAAA
CAAGCTGAGGGAATACTTAGCCTTATTGATGAGAAATGGGATGATCTCATAGCAAACATG
CCCCTCAAGATATGTTACCCCGCAATGGAAGATGATGAATGGCGCATTATTACCGGCAGT
GATCCTAAGAACACCCCATGGTCATATCATAATGGTGGATCCTGGCCAACGCTGCTGTGG
CAGTTTACATTGGCCTGTATCAAAATGGGAAGACCAGAGTTGGCCCGAAGAGCCATTGCT
GTGGCCGAGGAGAAGCTGGCAGCTGACAAATGGCCAGAGTACTATGACACCCGCTCTGGA
AGATTCATCGGGAAGCAATCTCGGTCATATCAGACATGGACTATTGCTGGTTTTCTGACC
TCTAAGATGCTATTGGAAAACCCCGAGCTGGCTTCTATTCTGACCTGCGATGAGGACCTC
GAGCTGCTTGAAGGCTGTGCATGCTGCCTTTCTAAGAAGAGAACTAGGTGCTCACGCCGT
GCAGCCAAGTCCCATGTCGTCGAGTAA

Protein

289 aa

>Os01t0332100-02 Similar to Invertase.
ALFYSALRCSREMLVMNDGSKNLLRAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEY
SHDATNKFNIYPEQIPSWLVDWIPEKGGYLIGNLQPAHMDFRFFSLGNLWAITSSLTTPK
QAEGILSLIDEKWDDLIANMPLKICYPAMEDDEWRIITGSDPKNTPWSYHNGGSWPTLLW
QFTLACIKMGRPELARRAIAVAEEKLAADKWPEYYDTRSGRFIGKQSRSYQTWTIAGFLT
SKMLLENPELASILTCDEDLELLEGCACCLSKKRTRCSRRAAKSHVVE*

CDS

chr01:12872493..12872986 (+ strand) : 494 bp

chr01:12873349..12873397 (+ strand) : 49 bp

chr01:12873488..12873811 (+ strand) : 324 bp

3'UTR

chr01:12873812..12874172 (+ strand) : 361 bp

FASTA

>Os01t0332100-02 class=Sequence position=chr01:12872493..12874172 (+ strand)
GCTTTGTTCT ACTCTGCCCT ACGATGCTCA CGAGAAATGC TTGTTATGAA CGATGGGTCA AAAAACCTCC TTCGTGCCAT
TAATAACAGG CTGAGTGCGC TGTCCTTTCA TATTAGGGAA TACTACTGGG TTGACATGAA GAAGATAAAT GAGATATACA
GATACAAAAC AGAAGAATAC TCTCATGATG CAACAAACAA ATTCAACATT TATCCTGAGC AAATCCCTTC TTGGCTTGTT
GACTGGATTC CTGAAAAAGG TGGCTATCTC ATCGGGAACC TGCAGCCAGC TCACATGGAT TTCAGGTTCT TCTCTCTCGG
CAACCTTTGG GCAATAACTT CATCTCTAAC TACTCCAAAA CAAGCTGAGG GAATACTTAG CCTTATTGAT GAGAAATGGG
ATGATCTCAT AGCAAACATG CCCCTCAAGA TATGTTACCC CGCAATGGAA GATGATGAAT GGCGCATTAT TACCGGCAGT
GATCCTAAGA ACACGTAAGG ATTCTTGAAC TGGTCTTTAT TGCTAGTATT TTCATGATCT ACGTTCAACC TGACCTCTTA
GTTAATGATA ATTTCACATA AATCATTGGC TGATCCAGTG AACACATGTA GTATCCACTA AATAAACATT GTAACCAGCT
GATATTATCT TGTAAGAAAT GTTTAGCAGA GCAAACACAT AATAACCGAA ACAAGGGCTC AAAACCTCTT CTGATTTATC
TTTTAAATAT CACCATATGC CCTGCTGCAC TCAGATTTTT TATGGGCAAC TTAGTTTGTT CGTGTAGCTT TTCATACGAC
GTGTTTCTAT TTCATTTCCA CAGTTGTTGA CATCTAAACA TTTTGTTAAT ATGCAGCCCA TGGTCATATC ATAATGGTGG
ATCCTGGCCA ACGCTGCTGT GGCAGGTATG GAGATATTGA CAGACTGTTT CCAAACTTTC TGCTCCTTTT ATGCTTATGA
ATCATCCCTT ACCAGTGTAT TTTATTTGTC TACAGTTTAC ATTGGCCTGT ATCAAAATGG GAAGACCAGA GTTGGCCCGA
AGAGCCATTG CTGTGGCCGA GGAGAAGCTG GCAGCTGACA AATGGCCAGA GTACTATGAC ACCCGCTCTG GAAGATTCAT
CGGGAAGCAA TCTCGGTCAT ATCAGACATG GACTATTGCT GGTTTTCTGA CCTCTAAGAT GCTATTGGAA AACCCCGAGC
TGGCTTCTAT TCTGACCTGC GATGAGGACC TCGAGCTGCT TGAAGGCTGT GCATGCTGCC TTTCTAAGAA GAGAACTAGG
TGCTCACGCC GTGCAGCCAA GTCCCATGTC GTCGAGTAAA ACAGCAGAGT CCCTTTTATA CATGCTACTC TGCACGCACA
AGTATACTAC GAGTACTTGT CGACAATTAA CTTGAGACGA ACACACTATA GCCATGTACA TTAGTATAGG TTTACACTAG
ATATCCATCC ATTCATTTTC CTCGATGCGC GCTCATTCGT TTTTGCTGAG CTGCCATCGA TGGGATTGGA GCTACCCTGG
GTGATACCGG TGGTCGACGA GAGCAACACC GATTCAGGTC TGTGGCTCTC GTGTACACAG GAAATTGAAG TTTGTTGTTG
TGTTCGGTCC ACCAGCAGCT CCTAATTCGG GAGTGCTGCG AAGCCCTAAC CATTGTATCC ATTGTCATTA TTTAAGCTGT

Locus: Os01g0332100

Loading...

Locus: Os01g0332100

Loading...