Os01t0348900-01

Locus

Os01g0348900

Description

Jacalin-related mannose-binding lectin, Salinity tolerance, Resistance to M. oryzae

RAP-DB Gene Symbol Synonym(s)

OsJRL, OsMBL1

RAP-DB Gene Name Synonym(s)

jacalin-related mannose-binding lectin, Mannose-Binding Lectin 1

CGSNL Gene Symbol

SALT

CGSNL Gene Name

SALT PROTEIN

Oryzabase Gene Symbol Synonym(s)

salT*(sal1), SalT1*, sal1, Sal1, SALT, ML, SalT, OsSalT, OsJRL, JRL, Osl43, OsL43, OsMBL1, MBL1

Oryzabase Gene Name Synonym(s)

salt tolerance, Salt tolerance-1, Salt stress-induced protein, Salt protein, Protein lectin-like, Protein mannose-binding lectin, 15 kda organ-specific salt-induced protein, Orysata, jacalin-related mannose-binding lectin, Mannose-Binding Lectin 1

Transcript Evidence

AK062520

AK105034

Protein Evidence

Q0JMY8

Literature

PMID: 30696749

PMID: 27718311

PMID: 11432928

Note

Manual Curation

April 8, 2019

Gene Ontology (GO)

Molecular Function: carbohydrate binding (GO:0030246)

Functional domain (InterPro)

Jacalin-like lectin domain superfamily (IPR036404)

Jacalin-like lectin domain (IPR001229)

Jacalin-like lectin domain, plant (IPR033734)

Experimentally confirmed subcellular location

nucleus (GO:0005634)

cytoplasm (GO:0005737)

Full-length cDNA

001-104-D03 (Online Clone Ordering)

001-031-D12 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0348900-01)

RiceXPro (AK062520)

Others

Oryzabase (451)

KEGG (Os01t0348900-01)

Transcript

684 bp

>Os01t0348900-01 Jacalin-related mannose-binding lectin, Salinity tolerance, Resistance to M. oryzae
ACACAACTACACAAGTCGACTATCATTACAAGGAAATTTAAGCGACCACGAAGAGTATGA
CGCTGGTGAAGATTGGTCCGTGGGGCGGAAATGGAGGGTCAGCTCAGGACATCAGTGTGC
CACCCAAGAAGCTGTTAGGCGTGACAATCTACAGCTCAGATGCAATCAGATCCATTGCCT
TCAACTACATCGGTGTGGATGGACAGGAATATGCCATTGGTCCATGGGGTGGGGGCGAAG
GCACCTCTACAGAGATTAAACTGGGCTCCTCTGAGCAGATCAAGGAGATTTCTGGAACCC
ATGGCCCAGTCTATGATCTGGCTGACATTGTCACCTATCTTAAGATTGTGACAAGTGCTA
ATAATACATACGAGGCTGGAGTCCCAAATGGAAAGGAATTCAGCATTCCACTGCAAGACT
CTGGCCATGTCGTTGGATTCTTTGGAAGGTCTGGAACGCTTATCGACGCAATTGGCATCT
ACGTCCACCCTTGATTCCCAGTGGTCAAAGAATTACTACCTACTACCATATCTACGAAAT
AATGTTCCATGGTGTTGTTGTACTTCATGCAATCCCCCCATTGTCTGTGTACGTGTTGCA
CCGATCCGTAGTACAATAAAGTTGGCGATATATATGTTGTCCCAGTCGACTTTTTAATAT
TTATTACTACAATAAGTTGGGGTC

CDS

438 bp

>Os01t0348900-01 Jacalin-related mannose-binding lectin, Salinity tolerance, Resistance to M. oryzae
ATGACGCTGGTGAAGATTGGTCCGTGGGGCGGAAATGGAGGGTCAGCTCAGGACATCAGT
GTGCCACCCAAGAAGCTGTTAGGCGTGACAATCTACAGCTCAGATGCAATCAGATCCATT
GCCTTCAACTACATCGGTGTGGATGGACAGGAATATGCCATTGGTCCATGGGGTGGGGGC
GAAGGCACCTCTACAGAGATTAAACTGGGCTCCTCTGAGCAGATCAAGGAGATTTCTGGA
ACCCATGGCCCAGTCTATGATCTGGCTGACATTGTCACCTATCTTAAGATTGTGACAAGT
GCTAATAATACATACGAGGCTGGAGTCCCAAATGGAAAGGAATTCAGCATTCCACTGCAA
GACTCTGGCCATGTCGTTGGATTCTTTGGAAGGTCTGGAACGCTTATCGACGCAATTGGC
ATCTACGTCCACCCTTGA

Protein

146 aa

>Os01t0348900-01 Jacalin-related mannose-binding lectin, Salinity tolerance, Resistance to M. oryzae
MTLVKIGPWGGNGGSAQDISVPPKKLLGVTIYSSDAIRSIAFNYIGVDGQEYAIGPWGGG
EGTSTEIKLGSSEQIKEISGTHGPVYDLADIVTYLKIVTSANNTYEAGVPNGKEFSIPLQ
DSGHVVGFFGRSGTLIDAIGIYVHP*

5'UTR

chr01:13904574..13904626 (- strand) : 53 bp

chr01:13904010..13904012 (- strand) : 3 bp

CDS

chr01:13903812..13904009 (- strand) : 198 bp

chr01:13903475..13903714 (- strand) : 240 bp

3'UTR

chr01:13903285..13903474 (- strand) : 190 bp

FASTA

>Os01t0348900-01 class=Sequence position=chr01:13903285..13904626 (- strand)
ACACAACTAC ACAAGTCGAC TATCATTACA AGGAAATTTA AGCGACCACG AAGGTATGAA AGCATAGCAG TACTCTGCAT
TTTTTTTTTT TGATGTTGTT CTAGCTAGCT CTGCTTAAGG TTTTCCTTTC TTTCGTTCTT TGTTTTTTTT TTGTAAGCTC
AACTAGTTGC ATGCAATTTA GATTTTATCC TTTTACAGTT GGAAAAACAT CCCTATAAAT ATTACCATGA ATGCATAGAG
ATTCGAGGAA GCTACAAATT GGACGACTGA TTCCAAAAAA AAAAAAAAAA TCAGATGGTC ACATCATTGC TATTGTTTTG
TGAAAGTACA AAAGCACTCG TTCGGATTCA AATTACTTGT GCAAATTAAT TAAAAACCAT AGAAATGATC ATGTTACCCC
TACACATTTC GGAAACAATA CCATATATGT TAGTGTGCGA TCATTCAAAT TGATTTATAT CTGAACAAAA CTGAGTGGGA
ATACGGTGAG CAAACTTGAC GATTCCAAAA TAATTTATAT TTAGGCAAAA TTTTACAACT TCAAAGTTCA AACAAGCTAA
CCTGAAAAAT CATGTTTGAA TTTACTAAGA TGTGCTTTTG TATTTACTAA ACAGAGTATG ACGCTGGTGA AGATTGGTCC
GTGGGGCGGA AATGGAGGGT CAGCTCAGGA CATCAGTGTG CCACCCAAGA AGCTGTTAGG CGTGACAATC TACAGCTCAG
ATGCAATCAG ATCCATTGCC TTCAACTACA TCGGTGTGGA TGGACAGGAA TATGCCATTG GTCCATGGGG TGGGGGCGAA
GGCACCTCTA CAGAGGTAAT TTACACTGCT TAATTAAGGT TAACCACTTA ATTTACAAGG TGATTCCTAT AATAGCAGAA
ATAATCCAAC AAATTAAACG ATGTTACTGC AGATTAAACT GGGCTCCTCT GAGCAGATCA AGGAGATTTC TGGAACCCAT
GGCCCAGTCT ATGATCTGGC TGACATTGTC ACCTATCTTA AGATTGTGAC AAGTGCTAAT AATACATACG AGGCTGGAGT
CCCAAATGGA AAGGAATTCA GCATTCCACT GCAAGACTCT GGCCATGTCG TTGGATTCTT TGGAAGGTCT GGAACGCTTA
TCGACGCAAT TGGCATCTAC GTCCACCCTT GATTCCCAGT GGTCAAAGAA TTACTACCTA CTACCATATC TACGAAATAA
TGTTCCATGG TGTTGTTGTA CTTCATGCAA TCCCCCCATT GTCTGTGTAC GTGTTGCACC GATCCGTAGT ACAATAAAGT
TGGCGATATA TATGTTGTCC CAGTCGACTT TTTAATATTT ATTACTACAA TAAGTTGGGG TC

Locus: Os01g0348900

Loading...

Locus: Os01g0348900

Loading...