Os01t0353400-01

Locus

Os01g0353400

Description

Glutathione S-transferase, Tolerance to salinity and oxidative stress, ROS-scavenging activity

RAP-DB Gene Symbol Synonym(s)

OsGST4

RAP-DB Gene Name Synonym(s)

glutathione S-transferase 4

CGSNL Gene Symbol

GSTF11

CGSNL Gene Name

PHI GLUTATHIONE S-TRANSFERASE 11

Oryzabase Gene Symbol Synonym(s)

OsGSTF11, OsGST4

Oryzabase Gene Name Synonym(s)

Transcript Evidence

BT068902 (maize)

Protein Evidence

Q0JMX6

Literature

PMID: 30303953

Note

Manual Curation

July 22, 2020

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

Thioredoxin-like superfamily (IPR036249)

Glutathione S-transferase, C-terminal domain superfamily (IPR036282)

Glutathione Transferase family (IPR040079)

Glutathione S-transferase, N-terminal (IPR004045)

Glutathione S-transferase, C-terminal-like (IPR010987)

Glutathione S-transferase, C-terminal (IPR004046)

Glutathione S-transferases Phi, C-terminal (IPR034347)

Expression Databases

TENOR (Os01t0353400-00)

Others

Oryzabase (9513)

KEGG (Os01t0353400-00 (EC:2.5.1.18))

Transcript

687 bp

>Os01t0353400-01 Glutathione S-transferase, Tolerance to salinity and oxidative stress, ROS-scavenging activity
ATGCTGGTGTGCCTGGAGGAGGCCGGCGTCGAGTACGAGGTCGTCCCGTTGAGCTTGACC
AACGGCGACCACCGCCGGCCGGAGCACCTCGCCCGGAACCCATTCGGTCAGATTCCAGTG
CTGGAGGACGGTGACCTGACACTCTACCAATCACACGCGATCGCTAGGTACGTTCTCGGC
AAGCACAAGCCGGAGCTCCTGGGGCTCGGCGAAGGCGGCAGCGTGGAGGAGTCGGCAATG
GTGGACATGTGGCTGGAGGTGGAGACCCACCAGTACGAGGCCGCCGTGAAGCCCATCGTG
TGGCACTGCCTCGTCCACCAGCACGTCGGCCTGGTGCGCGACCAGGGCGTCGTGGACGAG
AGCGTGGAGAAGCTGAGGGCGGTGCTGGAGGTGTACGAGGCGAGGCTGTCGTCGTCGTCG
GCCGGCAGGTACAGCTACCTCGCCGGCGGCGGCAGCGGCGACCGCGTCAGCCTCGCCGAC
CTCAGCCACGTCCCGCTGATGCACTACTTCACAGCGACGGAGTACGGCGGCGTGCTGGGC
GAGTACCCGCGCGTGAAGGCGTGGTGGGAGGCGCTGCTGGCGCGGCCGTCGGTGAAGAAG
GTGATCGCCGGCATGCCCACCGATTTCGGGTTCGGAAGTGGGAACTTGCCATAGTGCATT
AGTTGGCCTGATCGTCTGCCACACTAG

CDS

654 bp

>Os01t0353400-01 Glutathione S-transferase, Tolerance to salinity and oxidative stress, ROS-scavenging activity
ATGCTGGTGTGCCTGGAGGAGGCCGGCGTCGAGTACGAGGTCGTCCCGTTGAGCTTGACC
AACGGCGACCACCGCCGGCCGGAGCACCTCGCCCGGAACCCATTCGGTCAGATTCCAGTG
CTGGAGGACGGTGACCTGACACTCTACCAATCACACGCGATCGCTAGGTACGTTCTCGGC
AAGCACAAGCCGGAGCTCCTGGGGCTCGGCGAAGGCGGCAGCGTGGAGGAGTCGGCAATG
GTGGACATGTGGCTGGAGGTGGAGACCCACCAGTACGAGGCCGCCGTGAAGCCCATCGTG
TGGCACTGCCTCGTCCACCAGCACGTCGGCCTGGTGCGCGACCAGGGCGTCGTGGACGAG
AGCGTGGAGAAGCTGAGGGCGGTGCTGGAGGTGTACGAGGCGAGGCTGTCGTCGTCGTCG
GCCGGCAGGTACAGCTACCTCGCCGGCGGCGGCAGCGGCGACCGCGTCAGCCTCGCCGAC
CTCAGCCACGTCCCGCTGATGCACTACTTCACAGCGACGGAGTACGGCGGCGTGCTGGGC
GAGTACCCGCGCGTGAAGGCGTGGTGGGAGGCGCTGCTGGCGCGGCCGTCGGTGAAGAAG
GTGATCGCCGGCATGCCCACCGATTTCGGGTTCGGAAGTGGGAACTTGCCATAG

Protein

217 aa

>Os01t0353400-01 Glutathione S-transferase, Tolerance to salinity and oxidative stress, ROS-scavenging activity
MLVCLEEAGVEYEVVPLSLTNGDHRRPEHLARNPFGQIPVLEDGDLTLYQSHAIARYVLG
KHKPELLGLGEGGSVEESAMVDMWLEVETHQYEAAVKPIVWHCLVHQHVGLVRDQGVVDE
SVEKLRAVLEVYEARLSSSSAGRYSYLAGGGSGDRVSLADLSHVPLMHYFTATEYGGVLG
EYPRVKAWWEALLARPSVKKVIAGMPTDFGFGSGNLP*

CDS

chr01:14167662..14167760 (+ strand) : 99 bp

chr01:14167894..14167942 (+ strand) : 49 bp

chr01:14168032..14168537 (+ strand) : 506 bp

3'UTR

chr01:14168538..14168570 (+ strand) : 33 bp

FASTA

>Os01t0353400-01 class=Sequence position=chr01:14167662..14168570 (+ strand)
ATGCTGGTGT GCCTGGAGGA GGCCGGCGTC GAGTACGAGG TCGTCCCGTT GAGCTTGACC AACGGCGACC ACCGCCGGCC
GGAGCACCTC GCCCGGAACG TACGTACGCA TTGTCGTCAT TAATTCTCTG TTCCTGCCAA CTTGATCATA ACTGCTTTCC
TCTTGATGTT TTCTCCCTGA AGAAATTAAG AAAAATGCAG TTGAATGGTT AACTGACATG TCAATTCTGC AGCCATTCGG
TCAGATTCCA GTGCTGGAGG ACGGTGACCT GACACTCTAC CGTAAGCAAC CAATTGTGTT TTTCTTTATT TGTACGACTA
AATTTTGCGA TAACGAATGA AGTAAATCAT CTCCGTTTTT TTTTCATCAG AATCACACGC GATCGCTAGG TACGTTCTCG
GCAAGCACAA GCCGGAGCTC CTGGGGCTCG GCGAAGGCGG CAGCGTGGAG GAGTCGGCAA TGGTGGACAT GTGGCTGGAG
GTGGAGACCC ACCAGTACGA GGCCGCCGTG AAGCCCATCG TGTGGCACTG CCTCGTCCAC CAGCACGTCG GCCTGGTGCG
CGACCAGGGC GTCGTGGACG AGAGCGTGGA GAAGCTGAGG GCGGTGCTGG AGGTGTACGA GGCGAGGCTG TCGTCGTCGT
CGGCCGGCAG GTACAGCTAC CTCGCCGGCG GCGGCAGCGG CGACCGCGTC AGCCTCGCCG ACCTCAGCCA CGTCCCGCTG
ATGCACTACT TCACAGCGAC GGAGTACGGC GGCGTGCTGG GCGAGTACCC GCGCGTGAAG GCGTGGTGGG AGGCGCTGCT
GGCGCGGCCG TCGGTGAAGA AGGTGATCGC CGGCATGCCC ACCGATTTCG GGTTCGGAAG TGGGAACTTG CCATAGTGCA
TTAGTTGGCC TGATCGTCTG CCACACTAG

Locus: Os01g0353400

Loading...

Locus: Os01g0353400

Loading...