Os01t0357100-01

Locus

Os01g0357100

Description

Ferredoxin-nitrite reductase, Nitrate reduction (assimilation), Determination of regeneration ability

RAP-DB Gene Symbol Synonym(s)

NiR, OsNiR, PSR1

RAP-DB Gene Name Synonym(s)

PROMOTER OF SHOOT REGENERATION 1, Promoter of shoot regeneration 1, ferredoxin-nitrite reductase

CGSNL Gene Symbol

PSR1

CGSNL Gene Name

PROMOTOR OF SHOOT REGENERATION 1

Oryzabase Gene Symbol Synonym(s)

PSR1, NiR, OsNiR, OsNIR1, NIR1, FD-NiR, OsNiR2

Oryzabase Gene Name Synonym(s)

Promotor of shoot regeneration-1, ferredoxin-nitrite reductase, "Ferredoxin--nitrite reductase, chloroplastic"

Transcript Evidence

D50556 (Kinmaze)

AK103604 (6bp deletion)

Protein Evidence

Q42997

Literature

PMID: 16091467

PMID: 8541663

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

July 20, 2017

Gene Ontology (GO)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: oxidoreductase activity (GO:0016491)

Molecular Function: heme binding (GO:0020037)

Molecular Function: iron-sulfur cluster binding (GO:0051536)

Functional domain (InterPro)

Nitrite/Sulfite reductase ferredoxin-like domain (IPR005117)

Nitrite/sulphite reductase 4Fe-4S domain (IPR006067)

Nitrite/sulphite reductase iron-sulphur/sirohaem-binding site (IPR006066)

Full-length cDNA

J033133G10(6bp deletion) (Online Clone Ordering)

Expression Databases

TENOR (Os01t0357100-01)

RiceXPro (AK103604)

Others

Oryzabase (6344)

KEGG (Os01t0357100-01 (EC:1.7.7.1))

Transcript

2501 bp

>Os01t0357100-01 Ferredoxin-nitrite reductase, Nitrate reduction (assimilation), Determination of regeneration ability
GAACCTTATCTCCTTCTCTCTCGTCGCTTTCTGCGTCTCCCCGTCTCTCCTTCGCCAACA
GCCGAGAAGAGGCAGAGAGAGCGCCGCCCCCCGTCCCTCTCTCTCCCTCTCGTCCTCGCC
CCCATCCCTCTCGTCTTTCCCTTGCCGGCAGCAGAGGAGGCGGCAGCGACGGCTTCAGCT
GCTCCCACGGGCCGGATCGGGCAGTGGCGGTGGCGTCGGCGGCTTCCGCTGGCGAATCCG
GCGGGTGGATACAAATCAGTGTTCCGATAGGTAAAACCCTGCTCTCAGCATCTGCCCTTT
TGAATTCGCCAAGAGCCAGCATCTGCCCTTTTGAATTCGCCAAGGGCCAGCATCTGCCCA
TTTGATTTTGAATTCGCCAAGAGccagcaacagcgcccccgcgccccctccctcctccgc
aataaacagccacacgcgccgcccccatgtccaccctcatcgccacagcgcaccaccacc
accaccaccaccaccaccaccaccgtctccagccatggcctcctccgcctccctgcagcg
cttcctccccccgtacccccacgcggcagcatcccgctgccgccctcccggcgtccgcgC
CCGCCCCGTGCAGTCGTCGACGGTGTCCGCACCGTCCTCCTCGACTCCGGCGGCGGACGA
GGCCGTGTCGGCGGAGCGGCTGGAGCCGCGGGTGGAGCAGCGGGAGGGCCGGTACTGGGT
GCTCAAGGAGAAGTACCGGACGGGGCTGAACCCGCAGGAGAAGGTGAAGCTGGGGAAGGA
GCCCATGTCATTGTTCATGGAGGGCGGCATCAAGGAGCTCGCCAAGATGCCCATGGAGGA
GATCGAGGCCGACAAGCTCTCCAAGGAGGACATCGACGTGCGGCTCAAGTGGCTCGGCCT
CTTCCACCGCCGCAAGCATCAGTATGGGCGGTTCATGATGCGGCTGAAGCTGCCAAACGG
TGTGACGACGAGCGAGCAGACGAGGTACCTGGCGAGCGTGATCGAGGCGTACGGCAAGGA
GGGCTGCGCCGACGTGACAACCCGCCAGAACTGGCAGATCCGCGGCGTCACGCTCCCCGA
CGTGCCGGCCATCCTCGACGGGCTCAACGCCGTCGGCCTCACCAGCCTCCAGAGCGGCAT
GGACAACGTCCGCAACCCCGTCGGCAACCCGCTCGCCGGCATCGACCCCGACGAGATCGT
CGACACGCGATCCTACACCAACCTCCTCTCCTCCTACATCACCAGCAACTTCCAGGGCAA
CCCCACCATCACCAACCTGCCGAGGAAGTGGAACGTGTGCGTGATCGGGTCGCACGATCT
GTACGAGCACCCACACATCAACGACCTCGCGTACATGCCGGCGGTGAAGGGCGGCAAGTT
CGGGTTCAACCTCCTCGTCGGCGGGTTCATAAGCCCCAAGAGGTGGGAGGAGGCGCTGCC
GCTCGACGCCTGGGTCCCCGGCGACGACATCATCCCGGTGTGCAAGGCCGTTCTCGAGGC
GTACCGCGACCTCGGCACCAGGGGCAACCGCCAGAAGACCCGCATGATGTGGCTCATCGA
CGAACTTGGAATGGAGGCTTTTCGGTCGGAGGTGGAGAAGAGGATGCCGAACGGCGTGCT
GGAGCGCGCGGCGCCGGAGGACCTCATCGACAAGAAATGGCAGAGGAGGGACTACCTCGG
CGTGCACCCGCAGAAGCAGGAAGGGATGTCCTACGTCGGCCTGCACGTGCCCGTCGGCCG
GGTGCAGGCGGCGGACATGTTCGAGCTCGCACGCCTCGCCGACGAGTACGGCTCCGGCGA
GCTCCGCCTCACCGTGGAGCAGAACATCGTGATCCCGAACGTCAAGAACGAGAAGGTGGA
GGCGCTGCTCTCCGAGCCGCTGCTTCAGAAGTTCTCCCCGCAGCCGTCGCTGCTGCTCAA
GGGCCTCGTCGCGTGCACCGGCAACCAGTTCTGCGGCCAGGCCATCATCGAGACGAAGCA
GCGGGCGCTGCTGGTGACGTCGCAGGTGGAGAAGCTCGTGTCGGTGCCCCGGGCGGTGCG
GATGCACTGGACCGGCTGCCCCAACAGCTGCGGCCAGGTGCAGGTCGCCGACATCGGCTT
CATGGGCTGCCTCACCAAGGACAGCGCCGGCAAGATCGTTGAGGCGGCCGACATCTTCGT
CGGCGGCCGCGTCGGCAGCGACTCGCACCTCGCCGGCGCGTACAAGAAGTCCGTGCCGTG
CGACGAGCTGGCGCCGATCGTCGCCGACATCCTGGTCGAGCGGTTCGGGGCCGTGCGGAG
GGAGAGGGAGGAGGACGAGGAGTAGGAACACAGACTGGGGTGTTTTGCTTGCTCCGGTGA
TCTCTCGCCGTCCTTGTAAAGTAGACGACAATATGCCTTCGCCCATGGCACGCTTGTACT
GTCACGTTTTGGTTTGATCTTGTAGCCCAAAAGTTGTGTTCATTCTCGTTACAGTCTTAC
AGAGGATGATTGATTGATAAATAAAGAAGAAACAGATTCTG

CDS

1791 bp

>Os01t0357100-01 Ferredoxin-nitrite reductase, Nitrate reduction (assimilation), Determination of regeneration ability
atggcctcctccgcctccctgcagcgcttcctccccccgtacccccacgcggcagcatcc
cgctgccgccctcccggcgtccgcgCCCGCCCCGTGCAGTCGTCGACGGTGTCCGCACCG
TCCTCCTCGACTCCGGCGGCGGACGAGGCCGTGTCGGCGGAGCGGCTGGAGCCGCGGGTG
GAGCAGCGGGAGGGCCGGTACTGGGTGCTCAAGGAGAAGTACCGGACGGGGCTGAACCCG
CAGGAGAAGGTGAAGCTGGGGAAGGAGCCCATGTCATTGTTCATGGAGGGCGGCATCAAG
GAGCTCGCCAAGATGCCCATGGAGGAGATCGAGGCCGACAAGCTCTCCAAGGAGGACATC
GACGTGCGGCTCAAGTGGCTCGGCCTCTTCCACCGCCGCAAGCATCAGTATGGGCGGTTC
ATGATGCGGCTGAAGCTGCCAAACGGTGTGACGACGAGCGAGCAGACGAGGTACCTGGCG
AGCGTGATCGAGGCGTACGGCAAGGAGGGCTGCGCCGACGTGACAACCCGCCAGAACTGG
CAGATCCGCGGCGTCACGCTCCCCGACGTGCCGGCCATCCTCGACGGGCTCAACGCCGTC
GGCCTCACCAGCCTCCAGAGCGGCATGGACAACGTCCGCAACCCCGTCGGCAACCCGCTC
GCCGGCATCGACCCCGACGAGATCGTCGACACGCGATCCTACACCAACCTCCTCTCCTCC
TACATCACCAGCAACTTCCAGGGCAACCCCACCATCACCAACCTGCCGAGGAAGTGGAAC
GTGTGCGTGATCGGGTCGCACGATCTGTACGAGCACCCACACATCAACGACCTCGCGTAC
ATGCCGGCGGTGAAGGGCGGCAAGTTCGGGTTCAACCTCCTCGTCGGCGGGTTCATAAGC
CCCAAGAGGTGGGAGGAGGCGCTGCCGCTCGACGCCTGGGTCCCCGGCGACGACATCATC
CCGGTGTGCAAGGCCGTTCTCGAGGCGTACCGCGACCTCGGCACCAGGGGCAACCGCCAG
AAGACCCGCATGATGTGGCTCATCGACGAACTTGGAATGGAGGCTTTTCGGTCGGAGGTG
GAGAAGAGGATGCCGAACGGCGTGCTGGAGCGCGCGGCGCCGGAGGACCTCATCGACAAG
AAATGGCAGAGGAGGGACTACCTCGGCGTGCACCCGCAGAAGCAGGAAGGGATGTCCTAC
GTCGGCCTGCACGTGCCCGTCGGCCGGGTGCAGGCGGCGGACATGTTCGAGCTCGCACGC
CTCGCCGACGAGTACGGCTCCGGCGAGCTCCGCCTCACCGTGGAGCAGAACATCGTGATC
CCGAACGTCAAGAACGAGAAGGTGGAGGCGCTGCTCTCCGAGCCGCTGCTTCAGAAGTTC
TCCCCGCAGCCGTCGCTGCTGCTCAAGGGCCTCGTCGCGTGCACCGGCAACCAGTTCTGC
GGCCAGGCCATCATCGAGACGAAGCAGCGGGCGCTGCTGGTGACGTCGCAGGTGGAGAAG
CTCGTGTCGGTGCCCCGGGCGGTGCGGATGCACTGGACCGGCTGCCCCAACAGCTGCGGC
CAGGTGCAGGTCGCCGACATCGGCTTCATGGGCTGCCTCACCAAGGACAGCGCCGGCAAG
ATCGTTGAGGCGGCCGACATCTTCGTCGGCGGCCGCGTCGGCAGCGACTCGCACCTCGCC
GGCGCGTACAAGAAGTCCGTGCCGTGCGACGAGCTGGCGCCGATCGTCGCCGACATCCTG
GTCGAGCGGTTCGGGGCCGTGCGGAGGGAGAGGGAGGAGGACGAGGAGTAG

Protein

597 aa

>Os01t0357100-01 Ferredoxin-nitrite reductase, Nitrate reduction (assimilation), Determination of regeneration ability
MASSASLQRFLPPYPHAAASRCRPPGVRARPVQSSTVSAPSSSTPAADEAVSAERLEPRV
EQREGRYWVLKEKYRTGLNPQEKVKLGKEPMSLFMEGGIKELAKMPMEEIEADKLSKEDI
DVRLKWLGLFHRRKHQYGRFMMRLKLPNGVTTSEQTRYLASVIEAYGKEGCADVTTRQNW
QIRGVTLPDVPAILDGLNAVGLTSLQSGMDNVRNPVGNPLAGIDPDEIVDTRSYTNLLSS
YITSNFQGNPTITNLPRKWNVCVIGSHDLYEHPHINDLAYMPAVKGGKFGFNLLVGGFIS
PKRWEEALPLDAWVPGDDIIPVCKAVLEAYRDLGTRGNRQKTRMMWLIDELGMEAFRSEV
EKRMPNGVLERAAPEDLIDKKWQRRDYLGVHPQKQEGMSYVGLHVPVGRVQAADMFELAR
LADEYGSGELRLTVEQNIVIPNVKNEKVEALLSEPLLQKFSPQPSLLLKGLVACTGNQFC
GQAIIETKQRALLVTSQVEKLVSVPRAVRMHWTGCPNSCGQVQVADIGFMGCLTKDSAGK
IVEAADIFVGGRVGSDSHLAGAYKKSVPCDELAPIVADILVERFGAVRREREEDEE*

5'UTR

chr01:14446913..14447426 (+ strand) : 514 bp

CDS

chr01:14447427..14447835 (+ strand) : 409 bp

chr01:14451681..14452035 (+ strand) : 355 bp

chr01:14452138..14452426 (+ strand) : 289 bp

chr01:14452520..14453257 (+ strand) : 738 bp

3'UTR

chr01:14453258..14453453 (+ strand) : 196 bp

FASTA

>Os01t0357100-01 class=Sequence position=chr01:14446913..14453453 (+ strand)
GAACCTTATC TCCTTCTCTC TCGTCGCTTT CTGCGTCTCC CCGTCTCTCC TTCGCCAACA GCCGAGAAGA GGCAGAGAGA
GCGCCGCCCC CCGTCCCTCT CTCTCCCTCT CGTCCTCGCC CCCATCCCTC TCGTCTTTCC CTTGCCGGCA GCAGAGGAGG
CGGCAGCGAC GGCTTCAGCT GCTCCCACGG GCCGGATCGG GCAGTGGCGG TGGCGTCGGC GGCTTCCGCT GGCGAATCCG
GCGGGTGGAT ACAAATCAGT GTTCCGATAG GTAAAACCCT GCTCTCAGCA TCTGCCCTTT TGAATTCGCC AAGAGCCAGC
ATCTGCCCTT TTGAATTCGC CAAGGGCCAG CATCTGCCCA TTTGATTTTG AATTCGCCAA GAGccagcaa cagcgccccc
gcgccccctc cctcctccgc aataaacagc cacacgcgcc gcccccatgt ccaccctcat cgccacagcg caccaccacc
accaccacca ccaccaccac caccgtctcc agccatggcc tcctccgcct ccctgcagcg cttcctcccc ccgtaccccc
acgcggcagc atcccgctgc cgccctcccg gcgtccgcgC CCGCCCCGTG CAGTCGTCGA CGGTGTCCGC ACCGTCCTCC
TCGACTCCGG CGGCGGACGA GGCCGTGTCG GCGGAGCGGC TGGAGCCGCG GGTGGAGCAG CGGGAGGGCC GGTACTGGGT
GCTCAAGGAG AAGTACCGGA CGGGGCTGAA CCCGCAGGAG AAGGTGAAGC TGGGGAAGGA GCCCATGTCA TTGTTCATGG
AGGGCGGCAT CAAGGAGCTC GCCAAGATGC CCATGGAGGA GATCGAGGCC GACAAGCTCT CCAAGGAGGA CATCGACGTG
CGGCTCAAGT GGCTCGGCCT CTTCCACCGC CGCAAGCATC AGTGTATGCC TCTCTTCTCT TGCTCCTCTG ATCAACACAT
TTTCTTGCTT TCGTTCGGTT ATTTGTCGCG CCGAGGAAGT TAATTCGCCA AGATATTCTG CAGTTTTTTT TCTCGATGCA
CATTCAGCAA CCTAATTAAG ACTGATTAAG TTGCTGTGAT TTTTATAGCT TAATTACGGT CTCGTGGGTA ATGACTATTT
ATATTGAGTA AACATGGTTA CCTTTGATCC AATCACTTCA CCTCCATGTG CCATATATAG CCACAGGCTC TACCAAGTAA
CACTAGTAAT ATGCCTGTGA TACGCCACGG TGGCATAATA AATCATTAAA TTTTATTATA ATCAAATTAA GGATCCTAAA
ATTGGTCCAA TTGGGTGTTA ATTCGATGCA GGTCATATAA AAATATATTT TAGGCAAGGT GCAATTCAAG AGCATCAACC
ATTATATCCA ATCACTTTAA TATATATTTG AAGATAACAT ATGTCGGAAA AAAAATGATG GAGAGCTATT TCATTAACTT
GTGAGCATAA ACAGATCACC AGATGATGCC ACCATAAGTC CCGCCACAGT AAGTGATGCA GCTCATCTTG CCCTAGGCGT
TCGGTCTAAC CAGTAGATAG AAAGAGTACA ACATAGATCG AATGAAAAAA AAAATCTCCA GAAGAAAGCT CAACCACATT
GAGTAAATTA GAGCAACAAT CAAATCGAGT CAGCATATCG TTATGTTAGC AGAACCAATC ACCACAATTT GTTTCTCCTC
TTTATCTAAG TGTTTTGCCA GGTTAAAAGC ATATATCACT ATGTTCCAAG CAAACATCGG CAATGGACAT GTCAAAAATA
AATGATCAAT TGTTTCTTTG AGTACAAAAT TGACAATGGA CACTATGTTC CTTTGTTAGA ATTCTATTTG TCAGGGTAGG
ATGTAGAAAA ACTTAACTTT TAGAGGAAGC TTAAATATCC GGCATAAACT TGCTTTTTCA GCGCTCTATA AAATAATTCA
ACAGTGAATT GTCCATCTTT TCTAAGTGCT CCAAAAGACA CTAAGTTGAA AAACCAGGTG AACCAACAGA TTGATCCACA
AAATCTTATT ATTAGATTAT TCACTTAAAA GCCTGTCTTT ATTTCAAACA TATAAAAACA GAAGTTATTA ATCAGGGAAG
CGCTTATGGC AGCCTGAGCG AACCAGTGAT AGCAAGTGGT GAAAACAGTA AATAGGATAC ATAAAAATTA TACAAGGTTT
CTACTGTTTA TCAAAAAAAA ATATTTGAAA ACAGTAAATA GGATACATAA TCGACTTCCA ACTTGTCCTT ATCATAACAT
CCAGAATCAC AACAAGAATT GCAACGAATA CATAGTCGAC TTGAGCTAAG AAGTCACAAG ACCTGTCAAA GTAAGCTGCC
CTTGATCTTG AAGTGAAAGG CATATTTTAT TGTCTTCCTT GGCAAACAGA TATCACTGTC TTCAGCAGTT CAGTTAGATA
ATCCAAGATT TCTCACGGAG AAGAGCATAT CACTCGCATC AGTGTTGTGC CCTCCAAATA CTGAGATAAA CTGAATTTTG
TTCTCTTTGA AGCATCTGCA GGCATTAACA ATTATAATAC TTTACAAAGT TTCATTGGGT CTAAACTATT GTTTGCACAT
CATATATATG CCCAGAACTT TTTAGCATGA TACAAGGGTC CTGTTCATAA CTCATGCCTA AATCTGACAA ATTTGTCAAA
CGACAATATA AGTCGAATTA TAATGCGTTT TAGAATTGAC GCCAAAACTT TTGCTAGCGT AAGTAACTCT TCCACCTCCC
AGCATGCATA CAACCAACAA GCTAAACTTT TGTTCAAAAA AATGTACATT TATTTCCTTG AACACAGCCT TTGTAGAATA
TGATTAAAAA CTCATGGATG AATGAAATAA TGTAAAAGAA TGGTCAAAAT GATGAATAGT ACAAGAAGCA ACTGTGAACA
TTTCACCTTT ACCTGACTGT TCGCAAGAAG GCCACGTGGC AGAAAAGCCA GAAATGCAAG AAGCTTCCCT AATTGATACA
CCATCAAGAA ATCAATGGAC TCAACACCAG CGTCTGCCCA GACAAAATGA ATGCAGGCAC CTAAAATATA GAACCATTGA
CTTTTCAACA CTGAATTATA TAACCTGAAT ATCTTGTTTT TTTAACACAT CTGACAAAAT CAGTGCATTC TGTTCCATAT
AGATGTATGC ATAGCTCCCA TATGTTAGTT GATCGATGAG CATGCAAACT ATACACACCT TACGTTACTC CCTCTGTCAa
aaaaaatata agcttgtcta gatacatagc tacaaatgct tatatttttg gaTTCTCTTA AAGCTGTAGA AACTTTTATC
GCCCCGCCAT GGCAAGTCGA GATGCCATCC CCAATGAAAG CCCCCACACA GGTTTCATGC CCTGCTGCAC AATATTGAGC
AACCAAAAAT ATAATAATAT TTGTGTCAGA ATTTGAATCA ACCTTACAGA TACTGGGTGG CCAGAAAATC TAGTCCAAGT
AATATCCTGA AAAATAGCAA CTGGCAAATA CTAAAGGCAG TGAAGAGTTT CCTTTAGATC AGATGATAAA AAAAAATCAT
ATGTTCAATA GCAATAATCA CTCACATTTT TTTTGCTGTT TAGAATTTAG ATAATTAGTA GTTAAACTTC TATAGCTTGC
GTAGCTAAGA TCAATGGTGA TTATTAGTTG AAAAAATAAT CAAATCATCA AACTGAGGAG ACTTATACCT GCCATAAGTT
CTGAAATTTC AATGATCCTA GTCAATATTT ACTGTATATA TAGAATTAGG TCCAAAAGAT GATACTTACA ATTAAGGATG
TTGTATTGAT CGGTTCATAA CTCAAGCTTC TATTTATCAT TAATCAAAAG CTGGATCATT CATGCATATA CCTTTGCCGC
ACTCAACGTA GCAGCTCGGA GTCTTCTTTG TTCAGAAGCG AGGAAGGAGT CAACAAATAA GTACTGCAAT GTTAAACAAA
CCGACATATC AAATCCCAAA TTAAGAATGC ATGATTTATT AATACAGGAA ATATATGATC AAGTCCCAAA AAGTGAGTCA
TGTTATGTAC ACTCAGTCAT CAATTTCAAT AAGAATATTA ACTTGCTCAT TGGTATATGG ATTTGATTAT GACATAATTT
GACAATACAT TTACAGAATA AACTTGCAGT GCTGTGAGCA TATGTTACTA ACATGTAAGG ACCTTGTTTT GCTCTGTTCA
ATACTCATGT TGATCTTGAT CTGTGTCCAC ATATACCTAA ATGAAATGAA ATCAAAGAAT GAGGTTTGTA GGAGTGGAGT
TGGTGAATTA TAGGGTAGAT AATGTCGGCA CAACCGTTTG ATAAGTAGTA CGAGTACTTT ATTTGGCGCC ACCGCGCCAG
CATCAGATGT GTGGCCTTTG CACTGATTGA ATCCAAAAGA AAAAAAAAGT CGTTTTGGTC CCACACAATT CTACTTCATC
TGCAGGATGT ACAGAAGGTT ACATATCTAT TCTGTTCTAT GCTCTGTTTA CATTTATATT TATAGTACTA GGTTGAAAGG
GCTCACTTGG TGGCTGTCAT TGGTTGGCTG GTGCGGTATA TTACTAATAG GTTTTTTAAT GGCATATATG TTCTTAAAAT
AAACCAGAAA AGCAAAAGAT CAACTATCTT AGCCACACCA ATGAAATGGA ATATACTGAA CTGTCACGGC TAAAATTCTC
TTCAGTCACC TGGCCCAACT GGAGCCGTGG GCTCGTCGTC TTTTCTAAAC ATGTACTAGT ATTTTGGGGG CCCACAGTGA
ATTTGGCCCA AAATGCTGAC AGCCGCTCTA CGGCTCTACG CTGTGCAGAT GGGCGGTTCA TGATGCGGCT GAAGCTGCCA
AACGGTGTGA CGACGAGCGA GCAGACGAGG TACCTGGCGA GCGTGATCGA GGCGTACGGC AAGGAGGGCT GCGCCGACGT
GACAACCCGC CAGAACTGGC AGATCCGCGG CGTCACGCTC CCCGACGTGC CGGCCATCCT CGACGGGCTC AACGCCGTCG
GCCTCACCAG CCTCCAGAGC GGCATGGACA ACGTCCGCAA CCCCGTCGGC AACCCGCTCG CCGGCATCGA CCCCGACGAG
ATCGTCGACA CGCGATCCTA CACCAACCTC CTCTCCTCCT ACATCACCAG CAACTTCCAG GGCAACCCCA CCATCACCAA
CCTGTGAGTG ATCGAATCAA ATTGATCATG CTCTGTGCTG TGCTGTTTCG TGTCGTCTCT GACGACATGT TTGTTGAATT
TGTTGTTGCT GCGTGCTGTT GGCAGGCCGA GGAAGTGGAA CGTGTGCGTG ATCGGGTCGC ACGATCTGTA CGAGCACCCA
CACATCAACG ACCTCGCGTA CATGCCGGCG GTGAAGGGCG GCAAGTTCGG GTTCAACCTC CTCGTCGGCG GGTTCATAAG
CCCCAAGAGG TGGGAGGAGG CGCTGCCGCT CGACGCCTGG GTCCCCGGCG ACGACATCAT CCCGGTGTGC AAGGCCGTTC
TCGAGGCGTA CCGCGACCTC GGCACCAGGG GCAACCGCCA GAAGACCCGC ATGATGTGGC TCATCGACGA ACTTGTGAAC
CATTTTTTTC TCCATTCATC CACGCCATTG ACTGAATTAC GTATGTCCCA ATGTTCTTAT CAGTTAATTG CGGTGTTGGC
ATTGCAGGGA ATGGAGGCTT TTCGGTCGGA GGTGGAGAAG AGGATGCCGA ACGGCGTGCT GGAGCGCGCG GCGCCGGAGG
ACCTCATCGA CAAGAAATGG CAGAGGAGGG ACTACCTCGG CGTGCACCCG CAGAAGCAGG AAGGGATGTC CTACGTCGGC
CTGCACGTGC CCGTCGGCCG GGTGCAGGCG GCGGACATGT TCGAGCTCGC ACGCCTCGCC GACGAGTACG GCTCCGGCGA
GCTCCGCCTC ACCGTGGAGC AGAACATCGT GATCCCGAAC GTCAAGAACG AGAAGGTGGA GGCGCTGCTC TCCGAGCCGC
TGCTTCAGAA GTTCTCCCCG CAGCCGTCGC TGCTGCTCAA GGGCCTCGTC GCGTGCACCG GCAACCAGTT CTGCGGCCAG
GCCATCATCG AGACGAAGCA GCGGGCGCTG CTGGTGACGT CGCAGGTGGA GAAGCTCGTG TCGGTGCCCC GGGCGGTGCG
GATGCACTGG ACCGGCTGCC CCAACAGCTG CGGCCAGGTG CAGGTCGCCG ACATCGGCTT CATGGGCTGC CTCACCAAGG
ACAGCGCCGG CAAGATCGTT GAGGCGGCCG ACATCTTCGT CGGCGGCCGC GTCGGCAGCG ACTCGCACCT CGCCGGCGCG
TACAAGAAGT CCGTGCCGTG CGACGAGCTG GCGCCGATCG TCGCCGACAT CCTGGTCGAG CGGTTCGGGG CCGTGCGGAG
GGAGAGGGAG GAGGACGAGG AGTAGGAACA CAGACTGGGG TGTTTTGCTT GCTCCGGTGA TCTCTCGCCG TCCTTGTAAA
GTAGACGACA ATATGCCTTC GCCCATGGCA CGCTTGTACT GTCACGTTTT GGTTTGATCT TGTAGCCCAA AAGTTGTGTT
CATTCTCGTT ACAGTCTTAC AGAGGATGAT TGATTGATAA ATAAAGAAGA AACAGATTCT G