Os01t0357100-02

Locus

Os01g0357100

Description

Similar to Ferredoxin-nitrite reductase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PSR1

CGSNL Gene Name

PROMOTOR OF SHOOT REGENERATION 1

Oryzabase Gene Symbol Synonym(s)

PSR1, NiR, OsNiR, OsNIR1, NIR1, FD-NiR, OsNiR2

Oryzabase Gene Name Synonym(s)

Promotor of shoot regeneration-1, ferredoxin-nitrite reductase, "Ferredoxin--nitrite reductase, chloroplastic"

Transcript Evidence

AK061893 (DDBJ, Best hit)

Protein Evidence

B8YEL1 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: oxidoreductase activity (GO:0016491)

Molecular Function: heme binding (GO:0020037)

Molecular Function: iron-sulfur cluster binding (GO:0051536)

Functional domain (InterPro)

Nitrite/sulphite reductase, hemoprotein beta-component, ferrodoxin-like (IPR005117)

Nitrite/sulphite reductase iron-sulphur/siroheam-binding site (IPR006066)

Nitrite/sulphite reductase 4Fe-4S domain (IPR006067)

Full-length cDNA

001-041-G06 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0357100-02)

RiceXPro (AK061893)

Others

Oryzabase (6344)

KEGG (Os01t0357100-02 (EC:1.7.7.1))

Transcript

2137 bp

>Os01t0357100-02 Similar to Ferredoxin-nitrite reductase.
atcgccacagcgcaccaccaccaccaccaccaccaccaccaccaccgtctccagccatgg
cctcctccgcctccctgcagcgcttcctccccccgtacccccacgcggcagcatcccgct
gccgccctcccggcgtccgcgCCCGCCCCGTGCAGTCGTCGACGGTGTCCGCACCGTCCT
CCTCGACTCCGGCGGCGGACGAGGCCGTGTCGGCGGAGCGGCTGGAGCCGCGGGTGGAGC
AGCGGGAGGGCCGGTACTGGGTGCTCAAGGAGAAGTACCGGACGGGGCTGAACCCGCAGG
AGAAGGTGAAGCTGGGGAAGGAGCCCATGTCATTGTTCATGGAGGGCGGCATCAAGGAGC
TCGCCAAGATGCCCATGGAGGAGATCGAGGCCGACAAGCTCTCCAAGGAGGACATCGACG
TGCGGCTCAAGTGGCTCGGCCTCTTCCACCGCCGCAAGCATCAGTATGGGCGGTTCATGA
TGCGGCTGAAGCTGCCAAACGGTGTGACGACGAGCGAGCAGACGAGGTACCTGGCGAGCG
TGATCGAGGCGTACGGCAAGGAGGGCTGCGCCGACGTGACAACCCGCCAGAACTGGCAGA
TCCGCGGCGTCACGCTCCCCGACGTGCCGGCCATCCTCGACGGGCTCAACGCCGTCGGCC
TCACCAGCCTCCAGAGCGGCATGGACAACGTCCGCAACCCCGTCGGCAACCCGCTCGCCG
GCATCGACCCCGACGAGATCGTCGACACGCGATCCTACACCAACCTCCTCTCCTCCTACA
TCACCAGCAACTTCCAGGGCAACCCCACCATCACCAACCTGCCGAGGAAGTGGAACGTGT
GCGTGATCGGGTCGCACGATCTGTACGAGCACCCACACATCAACGACCTCGCGTACATGC
CGGCGGTGAAGGGCGGCAAGTTCGGGTTCAACCTCCTCGTCGGCGGGTTCATAAGCCCCA
AGAGGTGGGAGGAGGCGCTGCCGCTCGACGCCTGGGTCCCCGGCGACGACATCATCCCGG
TGTGCAAGGCCGTTCTCGAGGCGTACCGCGACCTCGGCACCAGGGGCAACCGCCAGAAGA
CCCGCATGATGTGGCTCATCGACGAACTTGTGAACCATTTTTTTCTCCATTCATCCACGC
CATTGACTGAATTACGTATGTCCCAATGTTCTTATCAGTTAATTGCGGTGTTGGCATTGC
AGGGAATGGAGGCTTTTCGGTCGGAGGTGGAGAAGAGGATGCCGAACGGCGTGCTGGAGC
GCGCGGCGCCGGAGGACCTCATCGACAAGAAATGGCAGAGGAGGGACTACCTCGGCGTGC
ACCCGCAGAAGCAGGAAGGGATGTCCTACGTCGGCCTGCACGTGCCCGTCGGCCGGGTGC
AGGCGGCGGACATGTTCGAGCTCGCACGCCTCGCCGACGAGTACGGCTCCGGCGAGCTCC
GCCTCACCGTGGAGCAGAACATCGTGATCCCGAACGTCAAGAACGAGAAGGTGGAGGCGC
TGCTCTCCGAGCCGCTGCTTCAGAAGTTCTCCCCGCAGCCGTCGCTGCTGCTCAAGGGCC
TCGTCGCGTGCACCGGCAACCAGTTCTGCGGCCAGGCCATCATCGAGACGAAGCAGCGGG
CGCTGCTGGTGACGTCGCAGGTGGAGAAGCTCGTGTCGGTGCCCCGGGCGGTGCGGATGC
ACTGGACCGGCTGCCCCAACAGCTGCGGCCAGGTGCAGGTCGCCGACATCGGCTTCATGG
GCTGCCTCACCAAGGACAGCGCCGGCAAGATCGTTGAGGCGGCCGACATCTTCGTCGGCG
GCCGCGTCGGCAGCGACTCGCACCTCGCCGGCGCGTACAAGAAGTCCGTGCCGTGCGACG
AGCTGGCGCCGATCGTCGCCGACATCCTGGTCGAGCGGTTCGGGGCCGTGCGGAGGGAGA
GGGAGGAGGACGAGGAGTAGGAACACAGACTGGGGTGTTTTGCTTGCTCCGGTGATCTCT
CGCCGTCCTTGTAAAGTAGACGACAATATGCCTTCGCCCATGGCACGCTTGTACTGTCAC
GTTTTGGTTTGATCTTGTAGCCCAAAAGTTGTGTTCATTCTCGTTACAGTCTTACAGAGG
ATGATTGATTGATAAATAAAGAAGAAACAGATTCTGC

CDS

1884 bp

>Os01t0357100-02 Similar to Ferredoxin-nitrite reductase.
atggcctcctccgcctccctgcagcgcttcctccccccgtacccccacgcggcagcatcc
cgctgccgccctcccggcgtccgcgCCCGCCCCGTGCAGTCGTCGACGGTGTCCGCACCG
TCCTCCTCGACTCCGGCGGCGGACGAGGCCGTGTCGGCGGAGCGGCTGGAGCCGCGGGTG
GAGCAGCGGGAGGGCCGGTACTGGGTGCTCAAGGAGAAGTACCGGACGGGGCTGAACCCG
CAGGAGAAGGTGAAGCTGGGGAAGGAGCCCATGTCATTGTTCATGGAGGGCGGCATCAAG
GAGCTCGCCAAGATGCCCATGGAGGAGATCGAGGCCGACAAGCTCTCCAAGGAGGACATC
GACGTGCGGCTCAAGTGGCTCGGCCTCTTCCACCGCCGCAAGCATCAGTATGGGCGGTTC
ATGATGCGGCTGAAGCTGCCAAACGGTGTGACGACGAGCGAGCAGACGAGGTACCTGGCG
AGCGTGATCGAGGCGTACGGCAAGGAGGGCTGCGCCGACGTGACAACCCGCCAGAACTGG
CAGATCCGCGGCGTCACGCTCCCCGACGTGCCGGCCATCCTCGACGGGCTCAACGCCGTC
GGCCTCACCAGCCTCCAGAGCGGCATGGACAACGTCCGCAACCCCGTCGGCAACCCGCTC
GCCGGCATCGACCCCGACGAGATCGTCGACACGCGATCCTACACCAACCTCCTCTCCTCC
TACATCACCAGCAACTTCCAGGGCAACCCCACCATCACCAACCTGCCGAGGAAGTGGAAC
GTGTGCGTGATCGGGTCGCACGATCTGTACGAGCACCCACACATCAACGACCTCGCGTAC
ATGCCGGCGGTGAAGGGCGGCAAGTTCGGGTTCAACCTCCTCGTCGGCGGGTTCATAAGC
CCCAAGAGGTGGGAGGAGGCGCTGCCGCTCGACGCCTGGGTCCCCGGCGACGACATCATC
CCGGTGTGCAAGGCCGTTCTCGAGGCGTACCGCGACCTCGGCACCAGGGGCAACCGCCAG
AAGACCCGCATGATGTGGCTCATCGACGAACTTGTGAACCATTTTTTTCTCCATTCATCC
ACGCCATTGACTGAATTACGTATGTCCCAATGTTCTTATCAGTTAATTGCGGTGTTGGCA
TTGCAGGGAATGGAGGCTTTTCGGTCGGAGGTGGAGAAGAGGATGCCGAACGGCGTGCTG
GAGCGCGCGGCGCCGGAGGACCTCATCGACAAGAAATGGCAGAGGAGGGACTACCTCGGC
GTGCACCCGCAGAAGCAGGAAGGGATGTCCTACGTCGGCCTGCACGTGCCCGTCGGCCGG
GTGCAGGCGGCGGACATGTTCGAGCTCGCACGCCTCGCCGACGAGTACGGCTCCGGCGAG
CTCCGCCTCACCGTGGAGCAGAACATCGTGATCCCGAACGTCAAGAACGAGAAGGTGGAG
GCGCTGCTCTCCGAGCCGCTGCTTCAGAAGTTCTCCCCGCAGCCGTCGCTGCTGCTCAAG
GGCCTCGTCGCGTGCACCGGCAACCAGTTCTGCGGCCAGGCCATCATCGAGACGAAGCAG
CGGGCGCTGCTGGTGACGTCGCAGGTGGAGAAGCTCGTGTCGGTGCCCCGGGCGGTGCGG
ATGCACTGGACCGGCTGCCCCAACAGCTGCGGCCAGGTGCAGGTCGCCGACATCGGCTTC
ATGGGCTGCCTCACCAAGGACAGCGCCGGCAAGATCGTTGAGGCGGCCGACATCTTCGTC
GGCGGCCGCGTCGGCAGCGACTCGCACCTCGCCGGCGCGTACAAGAAGTCCGTGCCGTGC
GACGAGCTGGCGCCGATCGTCGCCGACATCCTGGTCGAGCGGTTCGGGGCCGTGCGGAGG
GAGAGGGAGGAGGACGAGGAGTAG

Protein

628 aa

>Os01t0357100-02 Similar to Ferredoxin-nitrite reductase.
MASSASLQRFLPPYPHAAASRCRPPGVRARPVQSSTVSAPSSSTPAADEAVSAERLEPRV
EQREGRYWVLKEKYRTGLNPQEKVKLGKEPMSLFMEGGIKELAKMPMEEIEADKLSKEDI
DVRLKWLGLFHRRKHQYGRFMMRLKLPNGVTTSEQTRYLASVIEAYGKEGCADVTTRQNW
QIRGVTLPDVPAILDGLNAVGLTSLQSGMDNVRNPVGNPLAGIDPDEIVDTRSYTNLLSS
YITSNFQGNPTITNLPRKWNVCVIGSHDLYEHPHINDLAYMPAVKGGKFGFNLLVGGFIS
PKRWEEALPLDAWVPGDDIIPVCKAVLEAYRDLGTRGNRQKTRMMWLIDELVNHFFLHSS
TPLTELRMSQCSYQLIAVLALQGMEAFRSEVEKRMPNGVLERAAPEDLIDKKWQRRDYLG
VHPQKQEGMSYVGLHVPVGRVQAADMFELARLADEYGSGELRLTVEQNIVIPNVKNEKVE
ALLSEPLLQKFSPQPSLLLKGLVACTGNQFCGQAIIETKQRALLVTSQVEKLVSVPRAVR
MHWTGCPNSCGQVQVADIGFMGCLTKDSAGKIVEAADIFVGGRVGSDSHLAGAYKKSVPC
DELAPIVADILVERFGAVRREREEDEE*

5'UTR

chr01:14447371..14447426 (+ strand) : 56 bp

CDS

chr01:14447427..14447835 (+ strand) : 409 bp

chr01:14451681..14452035 (+ strand) : 355 bp

chr01:14452138..14453257 (+ strand) : 1120 bp

3'UTR

chr01:14453258..14453454 (+ strand) : 197 bp

FASTA

>Os01t0357100-02 class=Sequence position=chr01:14447371..14453454 (+ strand)
atcgccacag cgcaccacca ccaccaccac caccaccacc accaccgtct ccagccatgg cctcctccgc ctccctgcag
cgcttcctcc ccccgtaccc ccacgcggca gcatcccgct gccgccctcc cggcgtccgc gCCCGCCCCG TGCAGTCGTC
GACGGTGTCC GCACCGTCCT CCTCGACTCC GGCGGCGGAC GAGGCCGTGT CGGCGGAGCG GCTGGAGCCG CGGGTGGAGC
AGCGGGAGGG CCGGTACTGG GTGCTCAAGG AGAAGTACCG GACGGGGCTG AACCCGCAGG AGAAGGTGAA GCTGGGGAAG
GAGCCCATGT CATTGTTCAT GGAGGGCGGC ATCAAGGAGC TCGCCAAGAT GCCCATGGAG GAGATCGAGG CCGACAAGCT
CTCCAAGGAG GACATCGACG TGCGGCTCAA GTGGCTCGGC CTCTTCCACC GCCGCAAGCA TCAGTGTATG CCTCTCTTCT
CTTGCTCCTC TGATCAACAC ATTTTCTTGC TTTCGTTCGG TTATTTGTCG CGCCGAGGAA GTTAATTCGC CAAGATATTC
TGCAGTTTTT TTTCTCGATG CACATTCAGC AACCTAATTA AGACTGATTA AGTTGCTGTG ATTTTTATAG CTTAATTACG
GTCTCGTGGG TAATGACTAT TTATATTGAG TAAACATGGT TACCTTTGAT CCAATCACTT CACCTCCATG TGCCATATAT
AGCCACAGGC TCTACCAAGT AACACTAGTA ATATGCCTGT GATACGCCAC GGTGGCATAA TAAATCATTA AATTTTATTA
TAATCAAATT AAGGATCCTA AAATTGGTCC AATTGGGTGT TAATTCGATG CAGGTCATAT AAAAATATAT TTTAGGCAAG
GTGCAATTCA AGAGCATCAA CCATTATATC CAATCACTTT AATATATATT TGAAGATAAC ATATGTCGGA AAAAAAATGA
TGGAGAGCTA TTTCATTAAC TTGTGAGCAT AAACAGATCA CCAGATGATG CCACCATAAG TCCCGCCACA GTAAGTGATG
CAGCTCATCT TGCCCTAGGC GTTCGGTCTA ACCAGTAGAT AGAAAGAGTA CAACATAGAT CGAATGAAAA AAAAAATCTC
CAGAAGAAAG CTCAACCACA TTGAGTAAAT TAGAGCAACA ATCAAATCGA GTCAGCATAT CGTTATGTTA GCAGAACCAA
TCACCACAAT TTGTTTCTCC TCTTTATCTA AGTGTTTTGC CAGGTTAAAA GCATATATCA CTATGTTCCA AGCAAACATC
GGCAATGGAC ATGTCAAAAA TAAATGATCA ATTGTTTCTT TGAGTACAAA ATTGACAATG GACACTATGT TCCTTTGTTA
GAATTCTATT TGTCAGGGTA GGATGTAGAA AAACTTAACT TTTAGAGGAA GCTTAAATAT CCGGCATAAA CTTGCTTTTT
CAGCGCTCTA TAAAATAATT CAACAGTGAA TTGTCCATCT TTTCTAAGTG CTCCAAAAGA CACTAAGTTG AAAAACCAGG
TGAACCAACA GATTGATCCA CAAAATCTTA TTATTAGATT ATTCACTTAA AAGCCTGTCT TTATTTCAAA CATATAAAAA
CAGAAGTTAT TAATCAGGGA AGCGCTTATG GCAGCCTGAG CGAACCAGTG ATAGCAAGTG GTGAAAACAG TAAATAGGAT
ACATAAAAAT TATACAAGGT TTCTACTGTT TATCAAAAAA AAATATTTGA AAACAGTAAA TAGGATACAT AATCGACTTC
CAACTTGTCC TTATCATAAC ATCCAGAATC ACAACAAGAA TTGCAACGAA TACATAGTCG ACTTGAGCTA AGAAGTCACA
AGACCTGTCA AAGTAAGCTG CCCTTGATCT TGAAGTGAAA GGCATATTTT ATTGTCTTCC TTGGCAAACA GATATCACTG
TCTTCAGCAG TTCAGTTAGA TAATCCAAGA TTTCTCACGG AGAAGAGCAT ATCACTCGCA TCAGTGTTGT GCCCTCCAAA
TACTGAGATA AACTGAATTT TGTTCTCTTT GAAGCATCTG CAGGCATTAA CAATTATAAT ACTTTACAAA GTTTCATTGG
GTCTAAACTA TTGTTTGCAC ATCATATATA TGCCCAGAAC TTTTTAGCAT GATACAAGGG TCCTGTTCAT AACTCATGCC
TAAATCTGAC AAATTTGTCA AACGACAATA TAAGTCGAAT TATAATGCGT TTTAGAATTG ACGCCAAAAC TTTTGCTAGC
GTAAGTAACT CTTCCACCTC CCAGCATGCA TACAACCAAC AAGCTAAACT TTTGTTCAAA AAAATGTACA TTTATTTCCT
TGAACACAGC CTTTGTAGAA TATGATTAAA AACTCATGGA TGAATGAAAT AATGTAAAAG AATGGTCAAA ATGATGAATA
GTACAAGAAG CAACTGTGAA CATTTCACCT TTACCTGACT GTTCGCAAGA AGGCCACGTG GCAGAAAAGC CAGAAATGCA
AGAAGCTTCC CTAATTGATA CACCATCAAG AAATCAATGG ACTCAACACC AGCGTCTGCC CAGACAAAAT GAATGCAGGC
ACCTAAAATA TAGAACCATT GACTTTTCAA CACTGAATTA TATAACCTGA ATATCTTGTT TTTTTAACAC ATCTGACAAA
ATCAGTGCAT TCTGTTCCAT ATAGATGTAT GCATAGCTCC CATATGTTAG TTGATCGATG AGCATGCAAA CTATACACAC
CTTACGTTAC TCCCTCTGTC Aaaaaaaata taagcttgtc tagatacata gctacaaatg cttatatttt tggaTTCTCT
TAAAGCTGTA GAAACTTTTA TCGCCCCGCC ATGGCAAGTC GAGATGCCAT CCCCAATGAA AGCCCCCACA CAGGTTTCAT
GCCCTGCTGC ACAATATTGA GCAACCAAAA ATATAATAAT ATTTGTGTCA GAATTTGAAT CAACCTTACA GATACTGGGT
GGCCAGAAAA TCTAGTCCAA GTAATATCCT GAAAAATAGC AACTGGCAAA TACTAAAGGC AGTGAAGAGT TTCCTTTAGA
TCAGATGATA AAAAAAAATC ATATGTTCAA TAGCAATAAT CACTCACATT TTTTTTGCTG TTTAGAATTT AGATAATTAG
TAGTTAAACT TCTATAGCTT GCGTAGCTAA GATCAATGGT GATTATTAGT TGAAAAAATA ATCAAATCAT CAAACTGAGG
AGACTTATAC CTGCCATAAG TTCTGAAATT TCAATGATCC TAGTCAATAT TTACTGTATA TATAGAATTA GGTCCAAAAG
ATGATACTTA CAATTAAGGA TGTTGTATTG ATCGGTTCAT AACTCAAGCT TCTATTTATC ATTAATCAAA AGCTGGATCA
TTCATGCATA TACCTTTGCC GCACTCAACG TAGCAGCTCG GAGTCTTCTT TGTTCAGAAG CGAGGAAGGA GTCAACAAAT
AAGTACTGCA ATGTTAAACA AACCGACATA TCAAATCCCA AATTAAGAAT GCATGATTTA TTAATACAGG AAATATATGA
TCAAGTCCCA AAAAGTGAGT CATGTTATGT ACACTCAGTC ATCAATTTCA ATAAGAATAT TAACTTGCTC ATTGGTATAT
GGATTTGATT ATGACATAAT TTGACAATAC ATTTACAGAA TAAACTTGCA GTGCTGTGAG CATATGTTAC TAACATGTAA
GGACCTTGTT TTGCTCTGTT CAATACTCAT GTTGATCTTG ATCTGTGTCC ACATATACCT AAATGAAATG AAATCAAAGA
ATGAGGTTTG TAGGAGTGGA GTTGGTGAAT TATAGGGTAG ATAATGTCGG CACAACCGTT TGATAAGTAG TACGAGTACT
TTATTTGGCG CCACCGCGCC AGCATCAGAT GTGTGGCCTT TGCACTGATT GAATCCAAAA GAAAAAAAAA GTCGTTTTGG
TCCCACACAA TTCTACTTCA TCTGCAGGAT GTACAGAAGG TTACATATCT ATTCTGTTCT ATGCTCTGTT TACATTTATA
TTTATAGTAC TAGGTTGAAA GGGCTCACTT GGTGGCTGTC ATTGGTTGGC TGGTGCGGTA TATTACTAAT AGGTTTTTTA
ATGGCATATA TGTTCTTAAA ATAAACCAGA AAAGCAAAAG ATCAACTATC TTAGCCACAC CAATGAAATG GAATATACTG
AACTGTCACG GCTAAAATTC TCTTCAGTCA CCTGGCCCAA CTGGAGCCGT GGGCTCGTCG TCTTTTCTAA ACATGTACTA
GTATTTTGGG GGCCCACAGT GAATTTGGCC CAAAATGCTG ACAGCCGCTC TACGGCTCTA CGCTGTGCAG ATGGGCGGTT
CATGATGCGG CTGAAGCTGC CAAACGGTGT GACGACGAGC GAGCAGACGA GGTACCTGGC GAGCGTGATC GAGGCGTACG
GCAAGGAGGG CTGCGCCGAC GTGACAACCC GCCAGAACTG GCAGATCCGC GGCGTCACGC TCCCCGACGT GCCGGCCATC
CTCGACGGGC TCAACGCCGT CGGCCTCACC AGCCTCCAGA GCGGCATGGA CAACGTCCGC AACCCCGTCG GCAACCCGCT
CGCCGGCATC GACCCCGACG AGATCGTCGA CACGCGATCC TACACCAACC TCCTCTCCTC CTACATCACC AGCAACTTCC
AGGGCAACCC CACCATCACC AACCTGTGAG TGATCGAATC AAATTGATCA TGCTCTGTGC TGTGCTGTTT CGTGTCGTCT
CTGACGACAT GTTTGTTGAA TTTGTTGTTG CTGCGTGCTG TTGGCAGGCC GAGGAAGTGG AACGTGTGCG TGATCGGGTC
GCACGATCTG TACGAGCACC CACACATCAA CGACCTCGCG TACATGCCGG CGGTGAAGGG CGGCAAGTTC GGGTTCAACC
TCCTCGTCGG CGGGTTCATA AGCCCCAAGA GGTGGGAGGA GGCGCTGCCG CTCGACGCCT GGGTCCCCGG CGACGACATC
ATCCCGGTGT GCAAGGCCGT TCTCGAGGCG TACCGCGACC TCGGCACCAG GGGCAACCGC CAGAAGACCC GCATGATGTG
GCTCATCGAC GAACTTGTGA ACCATTTTTT TCTCCATTCA TCCACGCCAT TGACTGAATT ACGTATGTCC CAATGTTCTT
ATCAGTTAAT TGCGGTGTTG GCATTGCAGG GAATGGAGGC TTTTCGGTCG GAGGTGGAGA AGAGGATGCC GAACGGCGTG
CTGGAGCGCG CGGCGCCGGA GGACCTCATC GACAAGAAAT GGCAGAGGAG GGACTACCTC GGCGTGCACC CGCAGAAGCA
GGAAGGGATG TCCTACGTCG GCCTGCACGT GCCCGTCGGC CGGGTGCAGG CGGCGGACAT GTTCGAGCTC GCACGCCTCG
CCGACGAGTA CGGCTCCGGC GAGCTCCGCC TCACCGTGGA GCAGAACATC GTGATCCCGA ACGTCAAGAA CGAGAAGGTG
GAGGCGCTGC TCTCCGAGCC GCTGCTTCAG AAGTTCTCCC CGCAGCCGTC GCTGCTGCTC AAGGGCCTCG TCGCGTGCAC
CGGCAACCAG TTCTGCGGCC AGGCCATCAT CGAGACGAAG CAGCGGGCGC TGCTGGTGAC GTCGCAGGTG GAGAAGCTCG
TGTCGGTGCC CCGGGCGGTG CGGATGCACT GGACCGGCTG CCCCAACAGC TGCGGCCAGG TGCAGGTCGC CGACATCGGC
TTCATGGGCT GCCTCACCAA GGACAGCGCC GGCAAGATCG TTGAGGCGGC CGACATCTTC GTCGGCGGCC GCGTCGGCAG
CGACTCGCAC CTCGCCGGCG CGTACAAGAA GTCCGTGCCG TGCGACGAGC TGGCGCCGAT CGTCGCCGAC ATCCTGGTCG
AGCGGTTCGG GGCCGTGCGG AGGGAGAGGG AGGAGGACGA GGAGTAGGAA CACAGACTGG GGTGTTTTGC TTGCTCCGGT
GATCTCTCGC CGTCCTTGTA AAGTAGACGA CAATATGCCT TCGCCCATGG CACGCTTGTA CTGTCACGTT TTGGTTTGAT
CTTGTAGCCC AAAAGTTGTG TTCATTCTCG TTACAGTCTT ACAGAGGATG ATTGATTGAT AAATAAAGAA GAAACAGATT
CTGC