Os01t0369300-01

Locus

Os01g0369300

Description

Potassium uptake protein, kup domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

HAK3

CGSNL Gene Name

HIGH-AFFINITY POTASSIUM(K+) TRANSPORTER 3

Oryzabase Gene Symbol Synonym(s)

OsHAK3

Oryzabase Gene Name Synonym(s)

High-affinity Potassium(K+) Transporter 3, Probable potassium transporter 3

Transcript Evidence

AK109760 (DDBJ, Best hit)

Protein Evidence

B6U7Z6 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: potassium ion transmembrane transport (GO:0071805)

Cellular Component: membrane (GO:0016020)

Molecular Function: potassium ion transmembrane transporter activity (GO:0015079)

Functional domain (InterPro)

K+ potassium transporter (IPR003855)

Full-length cDNA

002-146-G08 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0369300-01)

RiceXPro (AK109760)

Others

Oryzabase (8657)

KEGG (Os01t0369300-01)

Transcript

1898 bp

>Os01t0369300-01 Potassium uptake protein, kup domain containing protein.
ACGGCGAATCGGAGAAGAAGCACGCAGTGAGAGAGAGTGCGCATGTCCGCAATTGGTGAC
TCCATCCCGGCCATCTTCCTCCCTCTCCTTTCATCTTCCAATAAAATAAAATGCCGGTGG
CCGACTGCGAAAGCGGTCTCTCGCCGGCAGATGTCACCGGTGCAGGTGCCGCAAACGGGA
ACCCGGGTCACTGGAGGAGCTACTACAGGCATGTGCTGCTGCTGGCGTACCAGAGCTGCG
GCGTGGTGTACGGCGACCTGAGCACGTCGCCGCTGTACGTGTACAAGAGCACCTTCATCA
TCGGGTCGCTCCGGCGGTTCCAGGACGAGGAGATCGTGTTCGGCGTCTTCTCCCTAGTGT
TCTGGACGCTGACCCTCATCCCGCTCCTCAAGTACGTCTTCATCGTGCTCGCCGCCGACG
ACAACGGCGAGGGCGGCACGTTCGCGCTCTACTCGCTGCTGGTGCGCCACGCCAAGTTCA
GCCTCATGCCAAACCAGGAGGCCGCCGACGAGGAGCTCACCTCCTACTACCGCCCCGGCT
ACGCCCCCCAGGAGACCCCCATCCTCACCGCGCTCCGTCGGTTCCTCGAGAACCACCGCA
AGTCCCGCACCTTCCTCCTCGTCACCGTCCTCTTCGGCGCCTCCCTCGTCATCGGCGACG
GCGTCCTCACGCCGCCCATGTCCGTGCTGTCGTCCTTCTCTGGGCTGCAAGTGCACTCGA
CCGCGCTGACGAGCGGGGAGGTGGAGATCCTGTCGTGCACGGTGCTGGTGTGCCTGTTCA
TGGTGCAGCACTGGGGCACGCACAGGGTGGCGTTCCTGTTCGCGCCGGTGGTCATCGTCT
GGCTCCTCCTCCTCGGGGCGCTCGGCGTCTACAACATCGTGGTGTGGAACCCCAGGGTGC
TGCGCGCCCTCTCCCCTTACTACCTCGTCAGGTTCTTCCAGCACACCGGCAAGGACGGCT
GGATCTCCCTCGGGGGAATTCTCCTCTCCATGACAGGGACCGAAGCCATGTATGCGGATC
TTGGCCACTTCACAGCTGCATCCATAAGGGTTGCGTTCGTGGGGCTCATCTACCCGTGCT
TGGTGCTGCAGTACATGGGGCAGGCGGCCTTCCTGTCCAAATCACCCCACTGCGACATCC
ACTTCGTATTCTTCGAGTCCATTCCAACGGGCATCTTCTGGCCGGTGCTGGTGATCGCGA
CGCTGGCGGCGATCGTGGGCAGCCAGGCGGTGATATCGGCGACCTTCTCCATCGTGCGGC
AGTGCACGGCGCTGGGCTGCTTCCCGCGCGTGAAGATCGTGCACACGTCGCGGCGGATCC
ACGGGCAGATCTACAGCCCGGAGATCAACTGGATCCTGATGCTGCTGTGCATCGCCGTCA
CCATGGGGCTCCGCGACACCACCCTCATCGGCAACGCCTACGGGATGGCGTGCGCGGGGG
TGATGCTGGTCACCACGCTGCTCATGGCGCTCGTCATCGTCTTCGTCTGGCAGTACAGCT
GCCTGGTGGCGGCGCTCTTCCTGGTGGCGTTCGGCGTCGTCGAGGCGGTGTACCTGTCGG
CGGCGCTGATGAAGGTGCCCCAGGGCGGGTGGCTGCCGCTGGTGCTGTCGCTGGTGTTCG
TCGCCGTCATGTACGTGTGGCACTACGGCACGCGGCGGAAGCACCAGTTCGACGTGCAGA
ACAAGGTGTCGCTCAGGTGGATCCACGCGCTCGGCCCCAGCCTGGGCATCGTGCGCGTCC
CGGGGATCGGCATCATCTACTCCGAGCTGGCCACCGGCGTGCCGGCCATCTTCTCGCACT
TCGTCACCAACCTGCCGGCGTTCCACCAGGTGCTCGTCTTCATCTGCGTCAAGGCCGTGC
CGGTGCCGCACGTCCGCGACGAGGAGCGCCACCTCGTC

CDS

1788 bp

>Os01t0369300-01 Potassium uptake protein, kup domain containing protein.
ATGCCGGTGGCCGACTGCGAAAGCGGTCTCTCGCCGGCAGATGTCACCGGTGCAGGTGCC
GCAAACGGGAACCCGGGTCACTGGAGGAGCTACTACAGGCATGTGCTGCTGCTGGCGTAC
CAGAGCTGCGGCGTGGTGTACGGCGACCTGAGCACGTCGCCGCTGTACGTGTACAAGAGC
ACCTTCATCATCGGGTCGCTCCGGCGGTTCCAGGACGAGGAGATCGTGTTCGGCGTCTTC
TCCCTAGTGTTCTGGACGCTGACCCTCATCCCGCTCCTCAAGTACGTCTTCATCGTGCTC
GCCGCCGACGACAACGGCGAGGGCGGCACGTTCGCGCTCTACTCGCTGCTGGTGCGCCAC
GCCAAGTTCAGCCTCATGCCAAACCAGGAGGCCGCCGACGAGGAGCTCACCTCCTACTAC
CGCCCCGGCTACGCCCCCCAGGAGACCCCCATCCTCACCGCGCTCCGTCGGTTCCTCGAG
AACCACCGCAAGTCCCGCACCTTCCTCCTCGTCACCGTCCTCTTCGGCGCCTCCCTCGTC
ATCGGCGACGGCGTCCTCACGCCGCCCATGTCCGTGCTGTCGTCCTTCTCTGGGCTGCAA
GTGCACTCGACCGCGCTGACGAGCGGGGAGGTGGAGATCCTGTCGTGCACGGTGCTGGTG
TGCCTGTTCATGGTGCAGCACTGGGGCACGCACAGGGTGGCGTTCCTGTTCGCGCCGGTG
GTCATCGTCTGGCTCCTCCTCCTCGGGGCGCTCGGCGTCTACAACATCGTGGTGTGGAAC
CCCAGGGTGCTGCGCGCCCTCTCCCCTTACTACCTCGTCAGGTTCTTCCAGCACACCGGC
AAGGACGGCTGGATCTCCCTCGGGGGAATTCTCCTCTCCATGACAGGGACCGAAGCCATG
TATGCGGATCTTGGCCACTTCACAGCTGCATCCATAAGGGTTGCGTTCGTGGGGCTCATC
TACCCGTGCTTGGTGCTGCAGTACATGGGGCAGGCGGCCTTCCTGTCCAAATCACCCCAC
TGCGACATCCACTTCGTATTCTTCGAGTCCATTCCAACGGGCATCTTCTGGCCGGTGCTG
GTGATCGCGACGCTGGCGGCGATCGTGGGCAGCCAGGCGGTGATATCGGCGACCTTCTCC
ATCGTGCGGCAGTGCACGGCGCTGGGCTGCTTCCCGCGCGTGAAGATCGTGCACACGTCG
CGGCGGATCCACGGGCAGATCTACAGCCCGGAGATCAACTGGATCCTGATGCTGCTGTGC
ATCGCCGTCACCATGGGGCTCCGCGACACCACCCTCATCGGCAACGCCTACGGGATGGCG
TGCGCGGGGGTGATGCTGGTCACCACGCTGCTCATGGCGCTCGTCATCGTCTTCGTCTGG
CAGTACAGCTGCCTGGTGGCGGCGCTCTTCCTGGTGGCGTTCGGCGTCGTCGAGGCGGTG
TACCTGTCGGCGGCGCTGATGAAGGTGCCCCAGGGCGGGTGGCTGCCGCTGGTGCTGTCG
CTGGTGTTCGTCGCCGTCATGTACGTGTGGCACTACGGCACGCGGCGGAAGCACCAGTTC
GACGTGCAGAACAAGGTGTCGCTCAGGTGGATCCACGCGCTCGGCCCCAGCCTGGGCATC
GTGCGCGTCCCGGGGATCGGCATCATCTACTCCGAGCTGGCCACCGGCGTGCCGGCCATC
TTCTCGCACTTCGTCACCAACCTGCCGGCGTTCCACCAGGTGCTCGTCTTCATCTGCGTC
AAGGCCGTGCCGGTGCCGCACGTCCGCGACGAGGAGCGCCACCTCGTC

Protein

595 aa

>Os01t0369300-01 Potassium uptake protein, kup domain containing protein.
MPVADCESGLSPADVTGAGAANGNPGHWRSYYRHVLLLAYQSCGVVYGDLSTSPLYVYKS
TFIIGSLRRFQDEEIVFGVFSLVFWTLTLIPLLKYVFIVLAADDNGEGGTFALYSLLVRH
AKFSLMPNQEAADEELTSYYRPGYAPQETPILTALRRFLENHRKSRTFLLVTVLFGASLV
IGDGVLTPPMSVLSSFSGLQVHSTALTSGEVEILSCTVLVCLFMVQHWGTHRVAFLFAPV
VIVWLLLLGALGVYNIVVWNPRVLRALSPYYLVRFFQHTGKDGWISLGGILLSMTGTEAM
YADLGHFTAASIRVAFVGLIYPCLVLQYMGQAAFLSKSPHCDIHFVFFESIPTGIFWPVL
VIATLAAIVGSQAVISATFSIVRQCTALGCFPRVKIVHTSRRIHGQIYSPEINWILMLLC
IAVTMGLRDTTLIGNAYGMACAGVMLVTTLLMALVIVFVWQYSCLVAALFLVAFGVVEAV
YLSAALMKVPQGGWLPLVLSLVFVAVMYVWHYGTRRKHQFDVQNKVSLRWIHALGPSLGI
VRVPGIGIIYSELATGVPAIFSHFVTNLPAFHQVLVFICVKAVPVPHVRDEERHLV

5'UTR

chr01:15157076..15157185 (- strand) : 110 bp

CDS

chr01:15157001..15157075 (- strand) : 75 bp

chr01:15154794..15155292 (- strand) : 499 bp

chr01:15154382..15154694 (- strand) : 313 bp

chr01:15154247..15154298 (- strand) : 52 bp

chr01:15153987..15154104 (- strand) : 118 bp

chr01:15153154..15153884 (- strand) : 731 bp

FASTA

>Os01t0369300-01 class=Sequence position=chr01:15153154..15157185 (- strand)
ACGGCGAATC GGAGAAGAAG CACGCAGTGA GAGAGAGTGC GCATGTCCGC AATTGGTGAC TCCATCCCGG CCATCTTCCT
CCCTCTCCTT TCATCTTCCA ATAAAATAAA ATGCCGGTGG CCGACTGCGA AAGCGGTCTC TCGCCGGCAG ATGTCACCGG
TGCAGGTGCC GCAAACGGGA ACCCGGTGAG CTATACATTT CCCCTTGCTC TGGCGTGCAT TGAAATCGCA TTTTCCAAAT
AATTTATTTA TTTGCCTCTT GTGATGAATT TGTGATATTG TGTAAGCATA CGGACATGAT GTGCACCCCT ACCGTTTGCA
ATTTTTTGCA TTTCTGTTAC CTAAACCAAC ATCGGTGCTG GTCCATCAAC GGAATCTGAC CCTTTTTTTT CCTTTTCTCT
TTATTTCCTC CTTTATGTTA CTGAGGTGTA GTAGGAAATG GTGTTGATTA ATGTACCCTG CATCTTATCT CTGACCATAC
TTATGGAAGA ATATATTACT AGTACCTAAT CAGGAAGAAC GATCCCAACT AAAATGTTAT TCTTGACTGA ATTATTTGAC
AATAACAGAG TGATTTGTTT GTTTTTTTTT CCAAGAGTGG ATCATGCAAG GAGAACATTT ACATTAAGAG TGGCATGCAG
TAGGAGTAGC TCATTGTTAT TTTACACCAC TAGTTACTAA CACCGTCCTA AAAATAGCTT GTGACCGAGT CAGACAGTGT
GAGCACAGAG GGCATCAGTA GTATACAGTA TTACCAATCC ATGAAGAATA CTGACGCTAG TTAAATAATT TTGCAATGTG
TATCACTTTA GTGCGACCAA TGATGGAAGG AAAATGGACA GCTTTTTTTT CCTACCGATT TTGTCTCTCC TCAGCCGAAC
CAGATTAAAA AAAAAAACTT AGGACATGTT TGGTTCTTGG CCATTGTTGG CCTTGCCAAT TTATTTGGCA TGGCAAGATT
TGATCATTGC CTCATTTTTT TTATTTATTT ATTTTTCTGC AAAGTGCTTG GATTGTTACC AAATGTTTTT GGCTAGGCTT
TGAATTTGGT TTGTTACCAC AAAGGGATGC TAATGTTTTG GTATGTGTTT TATTTGCTAC CTATGAAGTA TGCCAAAAAC
CAAATAATTT GGCATGACAA ATTATTTGGA TATAAAACAA ATGGATGACA GTTTTTGAGT AATGCCAAGT ATTTGGTATG
GTTAAGTTTA GTATTGAACC AAACATGCCC TTACATTGTG CAAAAGATGT GGTTGGGTCA TGTCCATCAA AAAATACACT
AAACCAAGTA AGACACGAGG AGAAAAAACG CGCAAACAAT GGTAATTGGG AGGAATATAT ATCGAAACAA GGTGAGTTAA
GACATGGAAT TTGTAACAAG TCGTTTTACA TGAAGAAATC TCGAACTTAG GATGATATAT TTAGGGTGAT TTTTGCAATC
TTCCCTAAAT TAAATAAGCA CGTATTTCTC CATATATTgg gcctgtttag ttcgcgaaaa gaaaattttt gggtgtcaca
tcagacgttt gaccggatgt cggaaggggt tttcggacac gaataaaaaa aactaatttc ataactcacc tggaaaccgc
gagacgaatc ttttgagcct aattaatccg tcattagcac atgtgggtta ctgtagcatt tatggctaat catggactaa
ttagactcaa aagattcgtc tcgcgatttc cctctaactg tgcaattagt tttttgattt atctatactt aattctccat
gtatgtgtca aaagattcaa tgcgatgttt ttaggaaaaa gtttttggga actaaacagg gccATAATAC GAAGAATGAA
AGTAATAATC TGATAAAATA ATAAATAATC AGTAGAATTA ATTACGGGTA CAGGGTCACT GGAGGAGCTA CTACAGGCAT
GTGCTGCTGC TGGCGTACCA GAGCTGCGGC GTGGTGTACG GCGACCTGAG CACGTCGCCG CTGTACGTGT ACAAGAGCAC
CTTCATCATC GGGTCGCTCC GGCGGTTCCA GGACGAGGAG ATCGTGTTCG GCGTCTTCTC CCTAGTGTTC TGGACGCTGA
CCCTCATCCC GCTCCTCAAG TACGTCTTCA TCGTGCTCGC CGCCGACGAC AACGGCGAGG GCGGCACGTT CGCGCTCTAC
TCGCTGCTGG TGCGCCACGC CAAGTTCAGC CTCATGCCAA ACCAGGAGGC CGCCGACGAG GAGCTCACCT CCTACTACCG
CCCCGGCTAC GCCCCCCAGG AGACCCCCAT CCTCACCGCG CTCCGTCGGT TCCTCGAGAA CCACCGCAAG TCCCGCACCT
TCCTCCTCGT CACCGTCCTC TTCGGCGCCT CCCTCGTCAT CGGCGACGGC GTCCTCACGC CGCCCATGTC CGGTGAGCGC
GCGTACCGTA ATACTACTAC TACTTGGTGT GTGGTTTGGG TTGCTGATGT GATCGATGAT CGATCTTTTG TCCTGGCTGC
TGGCTGGGCA GTGCTGTCGT CCTTCTCTGG GCTGCAAGTG CACTCGACCG CGCTGACGAG CGGGGAGGTG GAGATCCTGT
CGTGCACGGT GCTGGTGTGC CTGTTCATGG TGCAGCACTG GGGCACGCAC AGGGTGGCGT TCCTGTTCGC GCCGGTGGTC
ATCGTCTGGC TCCTCCTCCT CGGGGCGCTC GGCGTCTACA ACATCGTGGT GTGGAACCCC AGGGTGCTGC GCGCCCTCTC
CCCTTACTAC CTCGTCAGGT TCTTCCAGCA CACCGGCAAG GACGGCTGGA TCTCCCTCGG GGGAATTCTC CTCTCCATGA
CAGGCAAACA AACCTTATTT TGCTCGCTGC ACTGCGACTC ATCAACTACA TATTTTATAA TAATATATAT ATGTATGTAT
GTGCAGGGAC CGAAGCCATG TATGCGGATC TTGGCCACTT CACAGCTGCA TCCATAAGGG TATATGTGTC TGTTTATGCT
TGCTGTCAGA GCACTGATAG TGCAGTACTG CGTCTCGTTT AATATAATGC AGATTGATTT TAAGAGCAGG TTAAATATCT
TGACATTTGT TTGACACGTA CGTACGTACA CTTGTTGACA GGTTGCGTTC GTGGGGCTCA TCTACCCGTG CTTGGTGCTG
CAGTACATGG GGCAGGCGGC CTTCCTGTCC AAATCACCCC ACTGCGACAT CCACTTCGTA TTCTTCGAGT CCATTCCAAG
TAAGTGGAGT ACTCCTCTAA TCTACTGCTA ATCACTGGTG GTGAGGTGAC ATGAATCGTG ATACGACGAC ATCGATCCGA
ATGAAATGTC GCATTTTGCA GCGGGCATCT TCTGGCCGGT GCTGGTGATC GCGACGCTGG CGGCGATCGT GGGCAGCCAG
GCGGTGATAT CGGCGACCTT CTCCATCGTG CGGCAGTGCA CGGCGCTGGG CTGCTTCCCG CGCGTGAAGA TCGTGCACAC
GTCGCGGCGG ATCCACGGGC AGATCTACAG CCCGGAGATC AACTGGATCC TGATGCTGCT GTGCATCGCC GTCACCATGG
GGCTCCGCGA CACCACCCTC ATCGGCAACG CCTACGGGAT GGCGTGCGCG GGGGTGATGC TGGTCACCAC GCTGCTCATG
GCGCTCGTCA TCGTCTTCGT CTGGCAGTAC AGCTGCCTGG TGGCGGCGCT CTTCCTGGTG GCGTTCGGCG TCGTCGAGGC
GGTGTACCTG TCGGCGGCGC TGATGAAGGT GCCCCAGGGC GGGTGGCTGC CGCTGGTGCT GTCGCTGGTG TTCGTCGCCG
TCATGTACGT GTGGCACTAC GGCACGCGGC GGAAGCACCA GTTCGACGTG CAGAACAAGG TGTCGCTCAG GTGGATCCAC
GCGCTCGGCC CCAGCCTGGG CATCGTGCGC GTCCCGGGGA TCGGCATCAT CTACTCCGAG CTGGCCACCG GCGTGCCGGC
CATCTTCTCG CACTTCGTCA CCAACCTGCC GGCGTTCCAC CAGGTGCTCG TCTTCATCTG CGTCAAGGCC GTGCCGGTGC
CGCACGTCCG CGACGAGGAG CGCCACCTCG TC

Locus: Os01g0369300

Loading...

Locus: Os01g0369300

Loading...