Os01t0369300-02

Locus

Os01g0369300

Description

Potassium transporter 1 (AtPOT1) (AtKUP1) (AtKT1). Splice isoform 2.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

HAK3

CGSNL Gene Name

HIGH-AFFINITY POTASSIUM(K+) TRANSPORTER 3

Oryzabase Gene Symbol Synonym(s)

OsHAK3

Oryzabase Gene Name Synonym(s)

High-affinity Potassium(K+) Transporter 3, Probable potassium transporter 3

Transcript Evidence

AK100340 (DDBJ, Best hit)

Protein Evidence

Q1T721 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: potassium ion transmembrane transport (GO:0071805)

Cellular Component: membrane (GO:0016020)

Molecular Function: potassium ion transmembrane transporter activity (GO:0015079)

Functional domain (InterPro)

K+ potassium transporter (IPR003855)

Full-length cDNA

J023081N10 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0369300-02)

RiceXPro (AK100340)

Others

Oryzabase (8657)

KEGG (Os01t0369300-02)

Transcript

2159 bp

>Os01t0369300-02 Potassium transporter 1 (AtPOT1) (AtKUP1) (AtKT1). Splice isoform 2.
ACCACCGCAAGTCCCGCACCTTCCTCCTCGTCACCGTCCTCTTCGGCGCCTCCCTCGTCA
TCGGCGACGGCGTCCTCACGCCGCCCATGTCCGTGCTGTCGTCCTTCTCTGGGCTGCAAG
TGCACTCGACCGCGCTGACGAGCGGGGAGGTGGAGATCCTGTCGTGCACGGTGCTGGTGT
GCCTGTTCATGGTGCAGCACTGGGGCACGCACAGGGTGGCGTTCCTGTTCGCGCCGGTGG
TCATCGTCTGGCTCCTCCTCCTCGGGGCGCTCGGCGTCTACAACATCGTGGTGTGGAACC
CCAGGGTGCTGCGCGCCCTCTCCCCTTACTACCTCGTCAGGTTCTTCCAGCACACCGGCA
AGGACGGCTGGATCTCCCTCGGGGGAATTCTCCTCTCCATGACAGGGACCGAAGCCATGT
ATGCGGATCTTGGCCACTTCACAGCTGCATCCATAAGGGTTGCGTTCGTGGGGCTCATCT
ACCCGTGCTTGGTGCTGCAGTACATGGGGCAGGCGGCCTTCCTGTCCAAATCACCCCACT
GCGACATCCACTTCGTATTCTTCGAGTCCATTCCAACGGGCATCTTCTGGCCGGTGCTGG
TGATCGCGACGCTGGCGGCGATCGTGGGCAGCCAGGCGGTGATATCGGCGACCTTCTCCA
TCGTGCGGCAGTGCACGGCGCTGGGCTGCTTCCCGCGCGTGAAGATCGTGCACACGTCGC
GGCGGATCCACGGGCAGATCTACAGCCCGGAGATCAACTGGATCCTGATGCTGCTGTGCA
TCGCCGTCACCATGGGGCTCCGCGACACCACCCTCATCGGCAACGCCTACGGGATGGCGT
GCGCGGGGGTGATGCTGGTCACCACGCTGCTCATGGCGCTCGTCATCGTCTTCGTCTGGC
AGTACAGCTGCCTGGTGGCGGCGCTCTTCCTGGTGGCGTTCGGCGTCGTCGAGGCGGTGT
ACCTGTCGGCGGCGCTGATGAAGGTGCCCCAGGGCGGGTGGCTGCCGCTGGTGCTGTCGC
TGGTGTTCGTCGCCGTCATGTACGTGTGGCACTACGGCACGCGGCGGAAGCACCAGTTCG
ACGTGCAGAACAAGGTGTCGCTCAGGTGGATCCACGCGCTCGGCCCCAGCCTGGGCATCG
TGCGCGTCCCGGGGATCGGCATCATCTACTCCGAGCTGGCCACCGGCGTGCCGGCCATCT
TCTCGCACTTCGTCACCAACCTGCCGGCGTTCCACCAGGTGCTCGTCTTCATCTGCGTCA
AGGCCGTGCCGGTGCCGCACGTCCGCGACGAGGAGCGCCACCTCGTCGGCCGCATCGGCC
CGCGGGAGTTCCGCATGTACCGCTGCGTCGTTCGGCACGGCTACAAGGACGTGCTCGCCG
AGGACACCGACTTCGAGAACGACCTCGTGCTGCGGATCGCCGAGTTCGTGCAGATGGAGG
CCGACTTCGACCAGCGCTGCAGCATCAGCGACGATGGGGTCGTCGCCTCCGTGGAGGTGG
AGGGCCGCATGGCCGTGGTCCCGCGGCCCAGCGACCTTGCCAGGACGGGGCTCCTCATGC
GGGAGCCCGGCGAGGAGGAGAGCGTGGTGGCGCGCGCCGCCGCGGCCGCCAAGCCGGAGT
CGCTCATCCACTCGATGCACACGATGCACGAGGCGGAGTCGCCGGGGTTCGCGAGCCGGC
GGCGCGTGCGGTTCGAGGTGGCGAACCAGCACACGGACCCCAGGGTGAAGGAGGAGCTGA
GCGCGCTGGTGGAGGCCAAGCACGCCGGCGTCGCCTACATCATGGGCCACTCGTACATCA
AGGCGAGGAAGAGCTCGTCGGTGTTCAAGAAGTTCGCCGTCAACGTCGCCTACGCTTTCC
TCCGCAAGAATTGCAGAGGCCCCGGCCTCGTGCTCAACATCCCGCACATCAGCCTTATCG
AAGTCGGCATGATCTACTACGTCTAGTTTAGATATAAACTGCTTATTACCCCCAACATTT
TTTATTTTATTTTATACAGTACTAGGTCGTTTATTAGGCCTGCAGAACAATTAATGCAGG
GCGTGTCATCGACATGTATTTAGATTTAATAATAACGAGCTTAATAAACCACATATGCTA
ATGCTAGGCACTAGGCAGGTAAAGTGCCAGTGACTCTGCAATAAAGTTCTTTCTCCATG

CDS

1944 bp

>Os01t0369300-02 Potassium transporter 1 (AtPOT1) (AtKUP1) (AtKT1). Splice isoform 2.
CACCGCAAGTCCCGCACCTTCCTCCTCGTCACCGTCCTCTTCGGCGCCTCCCTCGTCATC
GGCGACGGCGTCCTCACGCCGCCCATGTCCGTGCTGTCGTCCTTCTCTGGGCTGCAAGTG
CACTCGACCGCGCTGACGAGCGGGGAGGTGGAGATCCTGTCGTGCACGGTGCTGGTGTGC
CTGTTCATGGTGCAGCACTGGGGCACGCACAGGGTGGCGTTCCTGTTCGCGCCGGTGGTC
ATCGTCTGGCTCCTCCTCCTCGGGGCGCTCGGCGTCTACAACATCGTGGTGTGGAACCCC
AGGGTGCTGCGCGCCCTCTCCCCTTACTACCTCGTCAGGTTCTTCCAGCACACCGGCAAG
GACGGCTGGATCTCCCTCGGGGGAATTCTCCTCTCCATGACAGGGACCGAAGCCATGTAT
GCGGATCTTGGCCACTTCACAGCTGCATCCATAAGGGTTGCGTTCGTGGGGCTCATCTAC
CCGTGCTTGGTGCTGCAGTACATGGGGCAGGCGGCCTTCCTGTCCAAATCACCCCACTGC
GACATCCACTTCGTATTCTTCGAGTCCATTCCAACGGGCATCTTCTGGCCGGTGCTGGTG
ATCGCGACGCTGGCGGCGATCGTGGGCAGCCAGGCGGTGATATCGGCGACCTTCTCCATC
GTGCGGCAGTGCACGGCGCTGGGCTGCTTCCCGCGCGTGAAGATCGTGCACACGTCGCGG
CGGATCCACGGGCAGATCTACAGCCCGGAGATCAACTGGATCCTGATGCTGCTGTGCATC
GCCGTCACCATGGGGCTCCGCGACACCACCCTCATCGGCAACGCCTACGGGATGGCGTGC
GCGGGGGTGATGCTGGTCACCACGCTGCTCATGGCGCTCGTCATCGTCTTCGTCTGGCAG
TACAGCTGCCTGGTGGCGGCGCTCTTCCTGGTGGCGTTCGGCGTCGTCGAGGCGGTGTAC
CTGTCGGCGGCGCTGATGAAGGTGCCCCAGGGCGGGTGGCTGCCGCTGGTGCTGTCGCTG
GTGTTCGTCGCCGTCATGTACGTGTGGCACTACGGCACGCGGCGGAAGCACCAGTTCGAC
GTGCAGAACAAGGTGTCGCTCAGGTGGATCCACGCGCTCGGCCCCAGCCTGGGCATCGTG
CGCGTCCCGGGGATCGGCATCATCTACTCCGAGCTGGCCACCGGCGTGCCGGCCATCTTC
TCGCACTTCGTCACCAACCTGCCGGCGTTCCACCAGGTGCTCGTCTTCATCTGCGTCAAG
GCCGTGCCGGTGCCGCACGTCCGCGACGAGGAGCGCCACCTCGTCGGCCGCATCGGCCCG
CGGGAGTTCCGCATGTACCGCTGCGTCGTTCGGCACGGCTACAAGGACGTGCTCGCCGAG
GACACCGACTTCGAGAACGACCTCGTGCTGCGGATCGCCGAGTTCGTGCAGATGGAGGCC
GACTTCGACCAGCGCTGCAGCATCAGCGACGATGGGGTCGTCGCCTCCGTGGAGGTGGAG
GGCCGCATGGCCGTGGTCCCGCGGCCCAGCGACCTTGCCAGGACGGGGCTCCTCATGCGG
GAGCCCGGCGAGGAGGAGAGCGTGGTGGCGCGCGCCGCCGCGGCCGCCAAGCCGGAGTCG
CTCATCCACTCGATGCACACGATGCACGAGGCGGAGTCGCCGGGGTTCGCGAGCCGGCGG
CGCGTGCGGTTCGAGGTGGCGAACCAGCACACGGACCCCAGGGTGAAGGAGGAGCTGAGC
GCGCTGGTGGAGGCCAAGCACGCCGGCGTCGCCTACATCATGGGCCACTCGTACATCAAG
GCGAGGAAGAGCTCGTCGGTGTTCAAGAAGTTCGCCGTCAACGTCGCCTACGCTTTCCTC
CGCAAGAATTGCAGAGGCCCCGGCCTCGTGCTCAACATCCCGCACATCAGCCTTATCGAA
GTCGGCATGATCTACTACGTCTAG

Protein

647 aa

>Os01t0369300-02 Potassium transporter 1 (AtPOT1) (AtKUP1) (AtKT1). Splice isoform 2.
HRKSRTFLLVTVLFGASLVIGDGVLTPPMSVLSSFSGLQVHSTALTSGEVEILSCTVLVC
LFMVQHWGTHRVAFLFAPVVIVWLLLLGALGVYNIVVWNPRVLRALSPYYLVRFFQHTGK
DGWISLGGILLSMTGTEAMYADLGHFTAASIRVAFVGLIYPCLVLQYMGQAAFLSKSPHC
DIHFVFFESIPTGIFWPVLVIATLAAIVGSQAVISATFSIVRQCTALGCFPRVKIVHTSR
RIHGQIYSPEINWILMLLCIAVTMGLRDTTLIGNAYGMACAGVMLVTTLLMALVIVFVWQ
YSCLVAALFLVAFGVVEAVYLSAALMKVPQGGWLPLVLSLVFVAVMYVWHYGTRRKHQFD
VQNKVSLRWIHALGPSLGIVRVPGIGIIYSELATGVPAIFSHFVTNLPAFHQVLVFICVK
AVPVPHVRDEERHLVGRIGPREFRMYRCVVRHGYKDVLAEDTDFENDLVLRIAEFVQMEA
DFDQRCSISDDGVVASVEVEGRMAVVPRPSDLARTGLLMREPGEEESVVARAAAAAKPES
LIHSMHTMHEAESPGFASRRRVRFEVANQHTDPRVKEELSALVEAKHAGVAYIMGHSYIK
ARKSSSVFKKFAVNVAYAFLRKNCRGPGLVLNIPHISLIEVGMIYYV*

5'UTR

chr01:15154885..15154886 (- strand) : 2 bp

CDS

chr01:15154794..15154884 (- strand) : 91 bp

chr01:15154382..15154694 (- strand) : 313 bp

chr01:15154247..15154298 (- strand) : 52 bp

chr01:15153987..15154104 (- strand) : 118 bp

chr01:15152515..15153884 (- strand) : 1370 bp

3'UTR

chr01:15152302..15152514 (- strand) : 213 bp

FASTA

>Os01t0369300-02 class=Sequence position=chr01:15152302..15154886 (- strand)
ACCACCGCAA GTCCCGCACC TTCCTCCTCG TCACCGTCCT CTTCGGCGCC TCCCTCGTCA TCGGCGACGG CGTCCTCACG
CCGCCCATGT CCGGTGAGCG CGCGTACCGT AATACTACTA CTACTTGGTG TGTGGTTTGG GTTGCTGATG TGATCGATGA
TCGATCTTTT GTCCTGGCTG CTGGCTGGGC AGTGCTGTCG TCCTTCTCTG GGCTGCAAGT GCACTCGACC GCGCTGACGA
GCGGGGAGGT GGAGATCCTG TCGTGCACGG TGCTGGTGTG CCTGTTCATG GTGCAGCACT GGGGCACGCA CAGGGTGGCG
TTCCTGTTCG CGCCGGTGGT CATCGTCTGG CTCCTCCTCC TCGGGGCGCT CGGCGTCTAC AACATCGTGG TGTGGAACCC
CAGGGTGCTG CGCGCCCTCT CCCCTTACTA CCTCGTCAGG TTCTTCCAGC ACACCGGCAA GGACGGCTGG ATCTCCCTCG
GGGGAATTCT CCTCTCCATG ACAGGCAAAC AAACCTTATT TTGCTCGCTG CACTGCGACT CATCAACTAC ATATTTTATA
ATAATATATA TATGTATGTA TGTGCAGGGA CCGAAGCCAT GTATGCGGAT CTTGGCCACT TCACAGCTGC ATCCATAAGG
GTATATGTGT CTGTTTATGC TTGCTGTCAG AGCACTGATA GTGCAGTACT GCGTCTCGTT TAATATAATG CAGATTGATT
TTAAGAGCAG GTTAAATATC TTGACATTTG TTTGACACGT ACGTACGTAC ACTTGTTGAC AGGTTGCGTT CGTGGGGCTC
ATCTACCCGT GCTTGGTGCT GCAGTACATG GGGCAGGCGG CCTTCCTGTC CAAATCACCC CACTGCGACA TCCACTTCGT
ATTCTTCGAG TCCATTCCAA GTAAGTGGAG TACTCCTCTA ATCTACTGCT AATCACTGGT GGTGAGGTGA CATGAATCGT
GATACGACGA CATCGATCCG AATGAAATGT CGCATTTTGC AGCGGGCATC TTCTGGCCGG TGCTGGTGAT CGCGACGCTG
GCGGCGATCG TGGGCAGCCA GGCGGTGATA TCGGCGACCT TCTCCATCGT GCGGCAGTGC ACGGCGCTGG GCTGCTTCCC
GCGCGTGAAG ATCGTGCACA CGTCGCGGCG GATCCACGGG CAGATCTACA GCCCGGAGAT CAACTGGATC CTGATGCTGC
TGTGCATCGC CGTCACCATG GGGCTCCGCG ACACCACCCT CATCGGCAAC GCCTACGGGA TGGCGTGCGC GGGGGTGATG
CTGGTCACCA CGCTGCTCAT GGCGCTCGTC ATCGTCTTCG TCTGGCAGTA CAGCTGCCTG GTGGCGGCGC TCTTCCTGGT
GGCGTTCGGC GTCGTCGAGG CGGTGTACCT GTCGGCGGCG CTGATGAAGG TGCCCCAGGG CGGGTGGCTG CCGCTGGTGC
TGTCGCTGGT GTTCGTCGCC GTCATGTACG TGTGGCACTA CGGCACGCGG CGGAAGCACC AGTTCGACGT GCAGAACAAG
GTGTCGCTCA GGTGGATCCA CGCGCTCGGC CCCAGCCTGG GCATCGTGCG CGTCCCGGGG ATCGGCATCA TCTACTCCGA
GCTGGCCACC GGCGTGCCGG CCATCTTCTC GCACTTCGTC ACCAACCTGC CGGCGTTCCA CCAGGTGCTC GTCTTCATCT
GCGTCAAGGC CGTGCCGGTG CCGCACGTCC GCGACGAGGA GCGCCACCTC GTCGGCCGCA TCGGCCCGCG GGAGTTCCGC
ATGTACCGCT GCGTCGTTCG GCACGGCTAC AAGGACGTGC TCGCCGAGGA CACCGACTTC GAGAACGACC TCGTGCTGCG
GATCGCCGAG TTCGTGCAGA TGGAGGCCGA CTTCGACCAG CGCTGCAGCA TCAGCGACGA TGGGGTCGTC GCCTCCGTGG
AGGTGGAGGG CCGCATGGCC GTGGTCCCGC GGCCCAGCGA CCTTGCCAGG ACGGGGCTCC TCATGCGGGA GCCCGGCGAG
GAGGAGAGCG TGGTGGCGCG CGCCGCCGCG GCCGCCAAGC CGGAGTCGCT CATCCACTCG ATGCACACGA TGCACGAGGC
GGAGTCGCCG GGGTTCGCGA GCCGGCGGCG CGTGCGGTTC GAGGTGGCGA ACCAGCACAC GGACCCCAGG GTGAAGGAGG
AGCTGAGCGC GCTGGTGGAG GCCAAGCACG CCGGCGTCGC CTACATCATG GGCCACTCGT ACATCAAGGC GAGGAAGAGC
TCGTCGGTGT TCAAGAAGTT CGCCGTCAAC GTCGCCTACG CTTTCCTCCG CAAGAATTGC AGAGGCCCCG GCCTCGTGCT
CAACATCCCG CACATCAGCC TTATCGAAGT CGGCATGATC TACTACGTCT AGTTTAGATA TAAACTGCTT ATTACCCCCA
ACATTTTTTA TTTTATTTTA TACAGTACTA GGTCGTTTAT TAGGCCTGCA GAACAATTAA TGCAGGGCGT GTCATCGACA
TGTATTTAGA TTTAATAATA ACGAGCTTAA TAAACCACAT ATGCTAATGC TAGGCACTAG GCAGGTAAAG TGCCAGTGAC
TCTGCAATAA AGTTCTTTCT CCATG

Locus: Os01g0369300

Loading...

Locus: Os01g0369300

Loading...