Os01t0370000-01

Locus

Os01g0370000

Description

NADH:flavin oxidoreductase/NADH oxidase, N-terminal domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

OPR9

CGSNL Gene Name

12-OXOPHYTODIENOATE REDUCTASE 9

Oryzabase Gene Symbol Synonym(s)

OsOPR9, OsOPR01-2, OPR2

Oryzabase Gene Name Synonym(s)

12-oxo-phytodienoic acid reductase 9

Transcript Evidence

AK121554 (DDBJ, Best hit)

Protein Evidence

Q5ZC83 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: metabolic process (GO:0008152)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: FMN binding (GO:0010181)

Molecular Function: oxidoreductase activity (GO:0016491)

Functional domain (InterPro)

NADH:flavin oxidoreductase/NADH oxidase, N-terminal (IPR001155)

Aldolase-type TIM barrel (IPR013785)

Full-length cDNA

J033033G12 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0370000-01)

Others

Oryzabase (8763)

Transcript

1609 bp

>Os01t0370000-01 NADH:flavin oxidoreductase/NADH oxidase, N-terminal domain containing protein.
AGCGAGCCGAAATAGCCTCGAAAGGAACAGAGGTGCGTTATATAGATCGGGCTGTCAAAA
GCATACAAACACACATGGAGGACACTCATCTCCTGACACCCTACAAGATGGGCCAGCTCA
ACCTGGCACACAGGATTGTACATGCACCGGTATCAAGGTTCAGATCATATGGGAGCATGC
CCCAGCCACACAATCTCCTCTACTACGCGCAGAGGGCGACGCCGGGCGCCCTCCTCATTG
CAGAGGCCAGCGCAGTCTCCTACGCTGCGTTGGGACGATCCAAGGACGACGCTGCGAACG
GTCCAATCCACCGCCAGCGTCCAGGTCCCCCTGGCTTTCTTTTCGGCACGAACTTAACAG
ACTATAATTCAGCTACAGATGGTGTCAAAGCAACTGAATCAGGGGTAAATGACCGGAATA
ACCTGTCAAAATGGTGGTTCATGTCACGCCTAAACGAGAGCGGGAATGCTGGTGGTGCTG
AAGAAAGCCACTACACGCTTCCGTCGTCCCTAGACGCGCCTGGACTTTGGAACCAGGAGC
AAATCGAGGCCTGGCGGCCGATCGTTGATGCCGTGCACGCCAAGGGCGCACTCTTCTTCT
GCCAAATCTGGCACAACGGTCGCGTGTTTTCAACGGATAATCCAGTAACACCTCAAGTCA
GCTATTTTGGAAATACCGATGACCTGGCACCGGCGGCACCTCAAAGGCTGGAAACAGGGG
AGATAGTCCAGATCGTCGAGGACTTCCGTGTGGCCGCTAGAAATGCCATCAAAGCTGGTT
TCGACGGCGTGGAGATCCATGCGGCCAACGGGCACCTGCTTCACCAGTTCATGAAGGCTA
GCGTAAACGACCGCACCGACGAGTACGGCGGCAGCGTGGAGAACCGCTGCCGCATCACCG
TGGATGCCATGTCCGCCGTCGCAGAGGAGATCGGCGCCGACCGCGTCGGCGTGCGCCTCT
CCCCGTTCGCGGACCACTGCCGCGAGGAAGGCACCGACCCGGAGGAGGTCGCGCTGCACC
TGATCGGCGTCATGAACGGCCTCGGCGTCCTCTACTGCCACGTGATCGAGCCGAGGTGCA
TGCGTGAGCAGCATCGAGGAGCACCGCGCGCGCCGCAACGTCCCGCACCGCCTGCTCCCG
TTCAGAAGGGCGTTCCACGGCacgttcattgtgaacggagggtacgaccgggaggaaggg
gacaaggcggtcggcgacggctacgccgacCTGGTGTCGTACGGGAGATTGTTCCTGGCC
AACCCCGACCTGCCGGAGAGGTTCAGGCAGAAGGCGGCTCTGAACGCGTATGACAGGAGC
ACCTTCTACACGCCTGATCCTGTGGTGGGCTACACGGACTACCCGTTTCTTGAGCAGCCT
CTAGCTGTTTGATTGATTCGACTGACCCATCTGTTGATACTATGGTCAAAGTTGGTGCAA
GTCAGCAATAAATTAAAGCTAGTTTGTGGTCGACCTTACGAATAAAATGGAGTGGTGGAC
ATGCATGTTACGCTACTTTGTATATGTAGCATTTTGCAAGAAGCCTATATCAGGGGCAAA
GTCACAGAGAGGCTGAGGGTGGTATAAAGAAACTCTTTTTTCTGTTTTT

CDS

1239 bp

>Os01t0370000-01 NADH:flavin oxidoreductase/NADH oxidase, N-terminal domain containing protein.
ATGGAGGACACTCATCTCCTGACACCCTACAAGATGGGCCAGCTCAACCTGGCACACAGG
ATTGTACATGCACCGGTATCAAGGTTCAGATCATATGGGAGCATGCCCCAGCCACACAAT
CTCCTCTACTACGCGCAGAGGGCGACGCCGGGCGCCCTCCTCATTGCAGAGGCCAGCGCA
GTCTCCTACGCTGCGTTGGGACGATCCAAGGACGACGCTGCGAACGGTCCAATCCACCGC
CAGCGTCCAGGTCCCCCTGGCTTTCTTTTCGGCACGAACTTAACAGACTATAATTCAGCT
ACAGATGGTGTCAAAGCAACTGAATCAGGGGTAAATGACCGGAATAACCTGTCAAAATGG
TGGTTCATGTCACGCCTAAACGAGAGCGGGAATGCTGGTGGTGCTGAAGAAAGCCACTAC
ACGCTTCCGTCGTCCCTAGACGCGCCTGGACTTTGGAACCAGGAGCAAATCGAGGCCTGG
CGGCCGATCGTTGATGCCGTGCACGCCAAGGGCGCACTCTTCTTCTGCCAAATCTGGCAC
AACGGTCGCGTGTTTTCAACGGATAATCCAGTAACACCTCAAGTCAGCTATTTTGGAAAT
ACCGATGACCTGGCACCGGCGGCACCTCAAAGGCTGGAAACAGGGGAGATAGTCCAGATC
GTCGAGGACTTCCGTGTGGCCGCTAGAAATGCCATCAAAGCTGGTTTCGACGGCGTGGAG
ATCCATGCGGCCAACGGGCACCTGCTTCACCAGTTCATGAAGGCTAGCGTAAACGACCGC
ACCGACGAGTACGGCGGCAGCGTGGAGAACCGCTGCCGCATCACCGTGGATGCCATGTCC
GCCGTCGCAGAGGAGATCGGCGCCGACCGCGTCGGCGTGCGCCTCTCCCCGTTCGCGGAC
CACTGCCGCGAGGAAGGCACCGACCCGGAGGAGGTCGCGCTGCACCTGATCGGCGTCATG
AACGGCCTCGGCGTCCTCTACTGCCACGTGATCGAGCCGAGGTGCATGCGTGAGCAGCAT
CGAGGAGCACCGCGCGCGCCGCAACGTCCCGCACCGCCTGCTCCCGTTCAGAAGGGCGTT
CCACGGCacgttcattgtgaacggagggtacgaccgggaggaaggggacaaggcggtcgg
cgacggctacgccgacCTGGTGTCGTACGGGAGATTGTTCCTGGCCAACCCCGACCTGCC
GGAGAGGTTCAGGCAGAAGGCGGCTCTGAACGCGTATGA

Protein

412 aa

>Os01t0370000-01 NADH:flavin oxidoreductase/NADH oxidase, N-terminal domain containing protein.
MEDTHLLTPYKMGQLNLAHRIVHAPVSRFRSYGSMPQPHNLLYYAQRATPGALLIAEASA
VSYAALGRSKDDAANGPIHRQRPGPPGFLFGTNLTDYNSATDGVKATESGVNDRNNLSKW
WFMSRLNESGNAGGAEESHYTLPSSLDAPGLWNQEQIEAWRPIVDAVHAKGALFFCQIWH
NGRVFSTDNPVTPQVSYFGNTDDLAPAAPQRLETGEIVQIVEDFRVAARNAIKAGFDGVE
IHAANGHLLHQFMKASVNDRTDEYGGSVENRCRITVDAMSAVAEEIGADRVGVRLSPFAD
HCREEGTDPEEVALHLIGVMNGLGVLYCHVIEPRCMREQHRGAPRAPQRPAPPAPVQKGV
PRHVHCERRVRPGGRGQGGRRRLRRPGVVREIVPGQPRPAGEVQAEGGSERV*

5'UTR

chr01:15195622..15195695 (- strand) : 74 bp

CDS

chr01:15195563..15195621 (- strand) : 59 bp

chr01:15194045..15194547 (- strand) : 503 bp

chr01:15193765..15193905 (- strand) : 141 bp

chr01:15193156..15193691 (- strand) : 536 bp

3'UTR

chr01:15192860..15193155 (- strand) : 296 bp

FASTA

>Os01t0370000-01 class=Sequence position=chr01:15192860..15195695 (- strand)
AGCGAGCCGA AATAGCCTCG AAAGGAACAG AGGTGCGTTA TATAGATCGG GCTGTCAAAA GCATACAAAC ACACATGGAG
GACACTCATC TCCTGACACC CTACAAGATG GGCCAGCTCA ACCTGGCACA CAGGTCAGTT ATGAACTAGT TACTCTCAAG
TAAAGAACTT GATTAGTTCG TCCACGGTCC ACCCCACCTA TAAAATTTCC TGAAAGTTGA GATGTCTTTT CTTTGGTACA
AACAATGTGT TACTTTCATA TATACGGGAC ACGTGATTGT ACTTTTGCAC AATTTTTCTT TTAAGAAATG TACTTTTACA
AGCTCTGAAA TTGGGAGTAT GTAAAAATAA ATGCAGCaaa ttttttgagg cagaaacttt tatatgtaac tacagtataa
ttaaagtgca attacattat aattacatta tgactgcaat gtaactgcgt tgcaaccata atataactta tataaaactt
ccaTTCAACT ATGGTTTGAT TAGCTAGCAC TGGGACATGT GATATGTGTG AAATTTTCTT TCTAGCAATT TTTTTCATTC
GTGCACAAAT CTCGAGGTGA TACGATGGTC ACAAATCTGA GTGTTTTTGG GGGAAAAGAA CTTGcagcct gtttggttgg
agggagatgg tgatggggaa tgggagttta tgatatctgg aagtttaagt ctgtagtttg gttgtagttt ggttggaaga
cttgggattt gagagtgttt gagatgggga attaagaggt ccaattccta caaatctctt acctggggga ggcctattaa
ttcgtgaaac ttggtgggat tcGACtaagg ctgtgtttag attcaaagtt tagatctaaa tttcagtctt ttttcatcac
atcaacctgt catacacaca caatttttca gtcacatcat cttcaatttc aatcaaaacc caaactttgc gctgaactaa
acacagcGCA AACAAGGGAT GGGAACTAAA AATGTAACTC CCATAACCAA TCATACCACC AACTCCCTCC TTGAAACTCC
CATTCATCTT CCCTTCTCTT GCCAAACAGG CTGTTGGGGG AAGTTTTCTA GCAAATCCGT GAAAAAATTA CTAAAATTCA
TTACGGAAAC TTACGGCGGT GGTTACAGGA TTGTACATGC ACCGGTATCA AGGTTCAGAT CATATGGGAG CATGCCCCAG
CCACACAATC TCCTCTACTA CGCGCAGAGG GCGACGCCGG GCGCCCTCCT CATTGCAGAG GCCAGCGCAG TCTCCTACGC
TGCGTTGGGA CGATCCAAGG ACGACGCTGC GAACGGTCCA ATCCACCGCC AGCGTCCAGG TCCCCCTGGC TTTCTTTTCG
GCACGAACTT AACAGACTAT AATTCAGCTA CAGATGGTGT CAAAGCAACT GAATCAGGGG TAAATGACCG GAATAACCTG
TCAAAATGGT GGTTCATGTC ACGCCTAAAC GAGAGCGGGA ATGCTGGTGG TGCTGAAGAA AGCCACTACA CGCTTCCGTC
GTCCCTAGAC GCGCCTGGAC TTTGGAACCA GGAGCAAATC GAGGCCTGGC GGCCGATCGT TGATGCCGTG CACGCCAAGG
GCGCACTCTT CTTCTGCCAA ATCTGGCACA ACGGTCGCGT GTTTTCAACG GGTATACTTA ACATGTTTAA TTCTTTATTA
CAACTCTTTT TTTTCTCTAG GAAGGGAGTA TTGGAAAGAG AACATTTTAC GGTATATATG CTCTTATTGT TTCACATAAA
CTTCCCTTCA TGCCCCGAAT TCAAACACAG ATAATCCAGT AACACCTCAA GTCAGCTATT TTGGAAATAC CGATGACCTG
GCACCGGCGG CACCTCAAAG GCTGGAAACA GGGGAGATAG TCCAGATCGT CGAGGACTTC CGTGTGGCCG CTAGAAATGC
CATCAAAGCT GGTAATATTT CACCATCTAA CTACTAGAGA TCTTACCAAG TTATTGATAC CGTTAGTCTT ACGCTTTGAC
GAAGGTTTCG ACGGCGTGGA GATCCATGCG GCCAACGGGC ACCTGCTTCA CCAGTTCATG AAGGCTAGCG TAAACGACCG
CACCGACGAG TACGGCGGCA GCGTGGAGAA CCGCTGCCGC ATCACCGTGG ATGCCATGTC CGCCGTCGCA GAGGAGATCG
GCGCCGACCG CGTCGGCGTG CGCCTCTCCC CGTTCGCGGA CCACTGCCGC GAGGAAGGCA CCGACCCGGA GGAGGTCGCG
CTGCACCTGA TCGGCGTCAT GAACGGCCTC GGCGTCCTCT ACTGCCACGT GATCGAGCCG AGGTGCATGC GTGAGCAGCA
TCGAGGAGCA CCGCGCGCGC CGCAACGTCC CGCACCGCCT GCTCCCGTTC AGAAGGGCGT TCCACGGCac gttcattgtg
aacggagggt acgaccggga ggaaggggac aaggcggtcg gcgacggcta cgccgacCTG GTGTCGTACG GGAGATTGTT
CCTGGCCAAC CCCGACCTGC CGGAGAGGTT CAGGCAGAAG GCGGCTCTGA ACGCGTATGA CAGGAGCACC TTCTACACGC
CTGATCCTGT GGTGGGCTAC ACGGACTACC CGTTTCTTGA GCAGCCTCTA GCTGTTTGAT TGATTCGACT GACCCATCTG
TTGATACTAT GGTCAAAGTT GGTGCAAGTC AGCAATAAAT TAAAGCTAGT TTGTGGTCGA CCTTACGAAT AAAATGGAGT
GGTGGACATG CATGTTACGC TACTTTGTAT ATGTAGCATT TTGCAAGAAG CCTATATCAG GGGCAAAGTC ACAGAGAGGC
TGAGGGTGGT ATAAAGAAAC TCTTTTTTCT GTTTTT

Locus: Os01g0370000

Loading...

Locus: Os01g0370000

Loading...