Os01t0370900-00

Locus

Os01g0370900

Description

Similar to Glutathione transferase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

GSTF8

CGSNL Gene Name

PHI GLUTATHIONE S-TRANSFERASE 8

Oryzabase Gene Symbol Synonym(s)

OsGSTF8

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK369124 (DDBJ)

Protein Evidence

Q8VWW3 (UniProt)

Literature

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Functional domain (InterPro)

Glutathione S-transferase, C-terminal (IPR004046)

Glutathione S-transferase, C-terminal-like (IPR010987)

Glutathione S-transferase/chloride channel, C-terminal (IPR017933)

Expression Databases

TENOR (Os01t0370900-00)

Others

Oryzabase (9510)

Transcript

753 bp

>Os01t0370900-00 Similar to Glutathione transferase.
CGGTGAAGGTGTTTGGTCCGGCCATGTCGACGAACGTGGCGCGGGTGCTGGTGTGCCTGG
AGGAGGTCGGTGTCGAGTACGAGCTCGTCAACATCGACTTCAAGGCCATGGAGCATAAGA
GCCCCGAACACCTCAAGCGCAACCCGTTTGGTCAAATGCCAGCTTTCCAGGACGGGGATC
TGCTTCTCTTCGGTCTGTAGTTCTTCTGTACTCTTGGACAGGAGTCATTTACCATCTAAA
ATATTCAGATTTAAGCAAATAAAACTGGCTAAATGCATTTCCTTTTCAGAGTCCCGCGCG
GTAGGAAGGTACATCCTTCGCAAGTACAAGACCAGCGAGGCCAACCTACTGCGGGAAGGC
AACCTGACTGAGGCGGCCATGGTGGACATCGGGATCGAGGTGGAGATACACCAGTACTAT
CCGGTGATCTCGTCGATCGTGTATGAATGCCTCTTCAACCCGGCCATGTACGGTGTCCCG
ACCAACCAAAAGGTGGTCGATAATAGCCTGGAGAAGCTGAAGAAAGTGCTGGAGGTGTAT
GAGGCCCGTCTATCGCAGAATACGTATTTGGCTGGCAATTTCCTCAGCTTTGTGGACCTC
AGCCACTTCCCCTTCACCTTCTACTTCATGGCGACGCCATACGCTTCACTACTCGACAAG
TACCCTCATGTGAAGGCATGGTGGGATGGGCTCGCGGCGAGGCCCTCCATAAAGAAGGTC
ACCGCTGCCATGGTTCTTCCCCTGAAGGCATAA

CDS

747 bp

>Os01t0370900-00 Similar to Glutathione transferase.
AGGTGTTTGGTCCGGCCATGTCGACGAACGTGGCGCGGGTGCTGGTGTGCCTGGAGGAGG
TCGGTGTCGAGTACGAGCTCGTCAACATCGACTTCAAGGCCATGGAGCATAAGAGCCCCG
AACACCTCAAGCGCAACCCGTTTGGTCAAATGCCAGCTTTCCAGGACGGGGATCTGCTTC
TCTTCGGTCTGTAGTTCTTCTGTACTCTTGGACAGGAGTCATTTACCATCTAAAATATTC
AGATTTAAGCAAATAAAACTGGCTAAATGCATTTCCTTTTCAGAGTCCCGCGCGGTAGGA
AGGTACATCCTTCGCAAGTACAAGACCAGCGAGGCCAACCTACTGCGGGAAGGCAACCTG
ACTGAGGCGGCCATGGTGGACATCGGGATCGAGGTGGAGATACACCAGTACTATCCGGTG
ATCTCGTCGATCGTGTATGAATGCCTCTTCAACCCGGCCATGTACGGTGTCCCGACCAAC
CAAAAGGTGGTCGATAATAGCCTGGAGAAGCTGAAGAAAGTGCTGGAGGTGTATGAGGCC
CGTCTATCGCAGAATACGTATTTGGCTGGCAATTTCCTCAGCTTTGTGGACCTCAGCCAC
TTCCCCTTCACCTTCTACTTCATGGCGACGCCATACGCTTCACTACTCGACAAGTACCCT
CATGTGAAGGCATGGTGGGATGGGCTCGCGGCGAGGCCCTCCATAAAGAAGGTCACCGCT
GCCATGGTTCTTCCCCTGAAGGCATAA

Protein

248 aa

>Os01t0370900-00 Similar to Glutathione transferase.
RCLVRPCRRTWRGCWCAWRRSVSSTSSSTSTSRPWSIRAPNTSSATRLVKCQLSRTGICF
SSVCSSSVLLDRSHLPSKIFRFKQIKLAKCISFSESRAVGRYILRKYKTSEANLLREGNL
TEAAMVDIGIEVEIHQYYPVISSIVYECLFNPAMYGVPTNQKVVDNSLEKLKKVLEVYEA
RLSQNTYLAGNFLSFVDLSHFPFTFYFMATPYASLLDKYPHVKAWWDGLAARPSIKKVTA
AMVLPLKA*

5'UTR

chr01:15260214..15260219 (- strand) : 6 bp

CDS

chr01:15260077..15260213 (- strand) : 137 bp

chr01:15259912..15259994 (- strand) : 83 bp

chr01:15258848..15259374 (- strand) : 527 bp

FASTA

>Os01t0370900-00 class=Sequence position=chr01:15258848..15260219 (- strand)
CGGTGAAGGT GTTTGGTCCG GCCATGTCGA CGAACGTGGC GCGGGTGCTG GTGTGCCTGG AGGAGGTCGG TGTCGAGTAC
GAGCTCGTCA ACATCGACTT CAAGGCCATG GAGCATAAGA GCCCCGAACA CCTCAAGCGC AACGTAAGCA CACGCTAACG
CTTGTGCTTA CTCTGCTTTT GTTTTCCTGT GCTCCCAGCT TGATCTCTGT GCTTTCCTCT CGCAGCCGTT TGGTCAAATG
CCAGCTTTCC AGGACGGGGA TCTGCTTCTC TTCGGTCTGT AGTTCTTCTG TACTCTTGGA CAGGAGTCGT GAATAGTTTG
GGAGACATCA TGAGAACACA GAACTAAACC AATCGACTGG CATGCATATT CGGCAGCTAA TTGAGATTTT ACAACTAAAC
AGAGCTTTTT GCAGGGAGTT CCACTGCGAT GCTCTCTATC GGTAGTAtaa agtaatctga atcgttgatt tcatttgatc
gaagtgctta aatctaagtt ttactagcat caaagctatc agtagtagaa acgtgaaggg aaattattta aaaaaatGCC
AGCCGGAGGA CTGGGGATCC AGAGCCCTTT TTCCTTTTGT TTTTCTTGAT AGAATATGAG CGATATCCGC GATAGTGAGA
TGGATGATCA CCGACCAACC TATATAGAGA AAAACATAAA TTACCCTAGT CACTGTATGA GTAAATTATT AATTTACCTT
TAATAATAAA TAATTCAGAT TATTTCCACC GATAATATAA TACTACAAAT ACATAGCATC ACATCGCTCA TTTGCGGCAC
AATAGATTTT CATATGTTTA CATTACAAAT AAATTTTTTT CACAGATTTA CCATCTAAAA TATTCAGATT TAAGCAAATA
AAACTGGCTA AATGCATTTC CTTTTCAGAG TCCCGCGCGG TAGGAAGGTA CATCCTTCGC AAGTACAAGA CCAGCGAGGC
CAACCTACTG CGGGAAGGCA ACCTGACTGA GGCGGCCATG GTGGACATCG GGATCGAGGT GGAGATACAC CAGTACTATC
CGGTGATCTC GTCGATCGTG TATGAATGCC TCTTCAACCC GGCCATGTAC GGTGTCCCGA CCAACCAAAA GGTGGTCGAT
AATAGCCTGG AGAAGCTGAA GAAAGTGCTG GAGGTGTATG AGGCCCGTCT ATCGCAGAAT ACGTATTTGG CTGGCAATTT
CCTCAGCTTT GTGGACCTCA GCCACTTCCC CTTCACCTTC TACTTCATGG CGACGCCATA CGCTTCACTA CTCGACAAGT
ACCCTCATGT GAAGGCATGG TGGGATGGGC TCGCGGCGAG GCCCTCCATA AAGAAGGTCA CCGCTGCCAT GGTTCTTCCC
CTGAAGGCAT AA

Locus: Os01g0370900

Loading...

Locus: Os01g0370900

Loading...