Os01t0372400-01

Locus

Os01g0372400

Description

Glutathione S-transferase, C-terminal-like domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

GSTF13

CGSNL Gene Name

PHI GLUTATHIONE S-TRANSFERASE 13

Oryzabase Gene Symbol Synonym(s)

OsGSTF13

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK108314 (DDBJ, Best hit)

Protein Evidence

Q9ZS18 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

Glutathione S-transferase, N-terminal (IPR004045)

Glutathione S-transferase, C-terminal (IPR004046)

Glutathione S-transferase, C-terminal-like (IPR010987)

Thioredoxin-like fold (IPR012336)

Glutathione S-transferase/chloride channel, C-terminal (IPR017933)

Full-length cDNA

002-141-G07 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0372400-01)

RiceXPro (AK108314)

Others

Oryzabase (9515)

KEGG (Os01t0372400-01)

Transcript

821 bp

>Os01t0372400-01 Glutathione S-transferase, C-terminal-like domain containing protein.
ACTGTGCACACATATGTAAGAATCCTACTATTATCCTTTCCCCGTTTCCGACCAGGCTTT
CCACAGAAAGCAGAGTAGCGAAGCACATGTCGCCGGTGAAGGTGTTCGGCTCGGCGCCGT
TCACGAACGTGGCGCGGGTGCTGCTCTGCCTGGAGGAGGTCGGCGCCGACTACGAGATCG
TCGACGTCGACTTCGGTGACAGGGAGCACAAGGGCCCCGACCACCTCGCCAGAAACCCGT
TTGGGCAAGTTCCGGCGTTCCAGGATGGAGACCTGATGCTCTTCGAGTCCCGTGCGATTT
GCCGGTACATACTGCGGAAGCACAGGGCGACGGACGAGGCCAACCTGCTGCGGGAAGGCG
ACCCCTCCGAGTCGGCGGTGGTGGACGCGTGGCTGGACGTGGAGGCGCTCCGGTACGAGC
CCTCGGTGCACGCCGTGTTCGTCCAGCGGCGCGTCGTCCCGGCGCTGGGCGGGGAGCCCG
ACGAGCGGGTCATCGCCGAGAGCGTCGCGCGGCTGAGGGAGACGCTCGCCGTGTACGAGG
CACGGCTGGAGGCCACGCGCGGGTACCTCGCCGGCGGCGAGGTGAGCCTCGCCGACCTGA
GCCACTTCCCGTACACGCGCTACTTCATGGAGATGCCGTACGAGGTGCCGGTGTTCGGCG
CGTACCCTCGCGTGACGGCGTGGTGGGAGCGCCTGCTGACGAGGCCGTCGGTCAGGAAGG
TGGCCGCCATGATGAGCGGCGGCGAGGGTTGATACGTGTGCTGATGCTTGCTACTGTTTT
CTTTTTCTTAAAAAAAGAGAATCAtactctctcattcccat

CDS

666 bp

>Os01t0372400-01 Glutathione S-transferase, C-terminal-like domain containing protein.
ATGTCGCCGGTGAAGGTGTTCGGCTCGGCGCCGTTCACGAACGTGGCGCGGGTGCTGCTC
TGCCTGGAGGAGGTCGGCGCCGACTACGAGATCGTCGACGTCGACTTCGGTGACAGGGAG
CACAAGGGCCCCGACCACCTCGCCAGAAACCCGTTTGGGCAAGTTCCGGCGTTCCAGGAT
GGAGACCTGATGCTCTTCGAGTCCCGTGCGATTTGCCGGTACATACTGCGGAAGCACAGG
GCGACGGACGAGGCCAACCTGCTGCGGGAAGGCGACCCCTCCGAGTCGGCGGTGGTGGAC
GCGTGGCTGGACGTGGAGGCGCTCCGGTACGAGCCCTCGGTGCACGCCGTGTTCGTCCAG
CGGCGCGTCGTCCCGGCGCTGGGCGGGGAGCCCGACGAGCGGGTCATCGCCGAGAGCGTC
GCGCGGCTGAGGGAGACGCTCGCCGTGTACGAGGCACGGCTGGAGGCCACGCGCGGGTAC
CTCGCCGGCGGCGAGGTGAGCCTCGCCGACCTGAGCCACTTCCCGTACACGCGCTACTTC
ATGGAGATGCCGTACGAGGTGCCGGTGTTCGGCGCGTACCCTCGCGTGACGGCGTGGTGG
GAGCGCCTGCTGACGAGGCCGTCGGTCAGGAAGGTGGCCGCCATGATGAGCGGCGGCGAG
GGTTGA

Protein

222 aa

>Os01t0372400-01 Glutathione S-transferase, C-terminal-like domain containing protein.
MSPVKVFGSAPFTNVARVLLCLEEVGADYEIVDVDFGDREHKGPDHLARNPFGQVPAFQD
GDLMLFESRAICRYILRKHRATDEANLLREGDPSESAVVDAWLDVEALRYEPSVHAVFVQ
RRVVPALGGEPDERVIAESVARLRETLAVYEARLEATRGYLAGGEVSLADLSHFPYTRYF
MEMPYEVPVFGAYPRVTAWWERLLTRPSVRKVAAMMSGGEG*

5'UTR

chr01:15344380..15344465 (+ strand) : 86 bp

CDS

chr01:15344466..15344615 (+ strand) : 150 bp

chr01:15344728..15344776 (+ strand) : 49 bp

chr01:15344874..15345340 (+ strand) : 467 bp

3'UTR

chr01:15345341..15345409 (+ strand) : 69 bp

FASTA

>Os01t0372400-01 class=Sequence position=chr01:15344380..15345409 (+ strand)
ACTGTGCACA CATATGTAAG AATCCTACTA TTATCCTTTC CCCGTTTCCG ACCAGGCTTT CCACAGAAAG CAGAGTAGCG
AAGCACATGT CGCCGGTGAA GGTGTTCGGC TCGGCGCCGT TCACGAACGT GGCGCGGGTG CTGCTCTGCC TGGAGGAGGT
CGGCGCCGAC TACGAGATCG TCGACGTCGA CTTCGGTGAC AGGGAGCACA AGGGCCCCGA CCACCTCGCC AGAAACGTAT
GTGTGCGCAG AGACAAGGAT TCATTTCTTT CTTGCTTTCG ACTAATTCAT TAAAAGAGAC AAATTATTGC CGAGTTGCAA
CTTGATTTTG TCGCTGGTGT TTCATCAGCC GTTTGGGCAA GTTCCGGCGT TCCAGGATGG AGACCTGATG CTCTTCGGTG
AGTAATATAC ACATTTGAAC TATCGAGCAA AAAGCATTCT CAGTTTCTCA CGAATTCGCC TCAAAATAAA ATTATTCAAT
CTTTGTGTTC AAAGAGTCCC GTGCGATTTG CCGGTACATA CTGCGGAAGC ACAGGGCGAC GGACGAGGCC AACCTGCTGC
GGGAAGGCGA CCCCTCCGAG TCGGCGGTGG TGGACGCGTG GCTGGACGTG GAGGCGCTCC GGTACGAGCC CTCGGTGCAC
GCCGTGTTCG TCCAGCGGCG CGTCGTCCCG GCGCTGGGCG GGGAGCCCGA CGAGCGGGTC ATCGCCGAGA GCGTCGCGCG
GCTGAGGGAG ACGCTCGCCG TGTACGAGGC ACGGCTGGAG GCCACGCGCG GGTACCTCGC CGGCGGCGAG GTGAGCCTCG
CCGACCTGAG CCACTTCCCG TACACGCGCT ACTTCATGGA GATGCCGTAC GAGGTGCCGG TGTTCGGCGC GTACCCTCGC
GTGACGGCGT GGTGGGAGCG CCTGCTGACG AGGCCGTCGG TCAGGAAGGT GGCCGCCATG ATGAGCGGCG GCGAGGGTTG
ATACGTGTGC TGATGCTTGC TACTGTTTTC TTTTTCTTAA AAAAAGAGAA TCAtactctc tcattcccat