Os01t0372500-00

Locus

Os01g0372500

Description

Similar to Leucoanthocyanidin dioxygenase (EC 1.14.11.19) (LDOX) (Leucocyanidin oxygenase) (Leucoanthocyanidin hydroxylase).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ANS

CGSNL Gene Name

ANTHOCYANIDIN SYNTHASE

Oryzabase Gene Symbol Synonym(s)

ANS, OsANS1, ANS1, LDOX

Oryzabase Gene Name Synonym(s)

anthocyanidin synthase, leucoanthocyanidin dioxygenase

Transcript Evidence

Y07955 (DDBJ, Best hit)

Protein Evidence

NP_001106074.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: iron ion binding (GO:0005506)

Molecular Function: oxidoreductase activity (GO:0016491)

Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors (GO:0016706)

Functional domain (InterPro)

Isopenicillin N synthase (IPR002283)

Oxoglutarate/iron-dependent oxygenase (IPR005123)

Expression Databases

TENOR (Os01t0372500-00)

RiceXPro (Y07955)

Others

Oryzabase (8280)

KEGG (Os01t0372500-00 (EC:1.14.11.19))

Transcript

1590 bp

>Os01t0372500-00 Similar to Leucoanthocyanidin dioxygenase (EC 1.14.11.19) (LDOX) (Leucocyanidin oxygenase) (Leucoanthocyanidin hydroxylase).
ATCGAGTACGTGCGCACGCAGCTCATCTACTAGCCTACTTCGGGAGGGCGACATGACGGA
TGTGGAGCTGAGAGTGGAGGCCCTCAGCCTCAGCGGCGTCTCCGCCATCCCGCCGGAGTA
CGTCCGCCCGGAGGAGGAgcgcgccgacctcggcgacgccctggagctcgcccgggccgc
gtccgacgacgacgccaccgcccgcatccccgtcgtcgacatctccgcgttcgacaacga
cggcgacggcaggcacgcgtgcgtggagGCGGTGCGCGCGGCGGCGGAGGAGTGGGGCGT
CATACACATCGCCGGCCACGGCCTCCCGGGCGACGTCCTCGGCCGCCTGCGCGCCGCGGG
CGAGGCGTTCTTCGCGCTGCCCATCGCGGAGAAGGAGGCGTACGCCAACGACCCGGCGGC
GGGGCGGCTGCAGGGGTACGGCAGCAAGCTCGCCGCCAACGCCAGCGGGAAGAGGGAGTG
GGAGGACTACCTGTTCCACCTCGTCCACCCGGACCACCTCGCCGACCACTCGCTCTGGCC
GGCGAACCCGCCGGAGTACGTCCCCGTGTCGCGCGACTTCGGCGGCCGCGTCCGGACCCT
CGCATCCAAGCTGCTCGCCATCCTCTCCCTCGGCCTCGGCCTGCCGGAAGAGACGCTGGA
ACGCCGCCTGAGAGGACATGAGCTGGCCGGCGTCGACGACGACCTGCTCCTTCAGCTCAA
GATCAACTACTACCCGAGGTGCCCGCGGCCTGACCTCGCCGTCGGCGTCGAGGCACACAC
CGACGTCAGCGCGCTCTCCTTCATCCTCCACAACGGCGTGCCGGGGCTGCAGGTGCACCA
CGCCGGGAGCTGGGTCACCGCGCGCCCCGAGCCGGGCACCATCGTCGTCCACGTCGGCGA
CGCCCTGGAGATCCTCACCAACGGCCGGTACACCAGCGTGCTCCACCGCGGCCTCGTCAG
CCGCGACGCCGTGCGCCTCTCCTGGGTCGTCTTCTGCGAGCCGCCGCCTGAGTCCGTGCT
GCTGCAGCCGGTGCCGGAGCTGCTCGCCGACGGCGCCGACAAGCCGCTCTTCGCGCCGCG
CACATTCAAGCAGCACGTGCAACGCAAGCTGTTCGAGAAGCTCAAGGATCAGCAAGACAA
CAATGCCGCAGCTGCATCGAACGGAATGAGAACTAAATAATTGCAATTAGTCGATCTATC
GGCTAGACAACCCAATATTTTGAAAAATTGATGGACACACAAAAAAAACTTTTTTATATA
AGAATATGCATTTGGTTGATTCAACATGAAAAATATTTTCAAACCATTATATTTTTAATT
GGTTATGAATAAACTATAAAAATAATTGCATTCGTCTGAATTTCAGATAAAGGAGAACAA
ATAATGTTCAACGGAAGCGAAAGCCGGGGAAATGTACGGATGTTATATCGAGAGCTTAAC
TTATGAGATGTCTTATATTTTGTTGTCTATGTATTGCAGTCGACTTGTACACCGAGTCTT
TCCATCCCTATTAAGAGCTGGAGCTCAATATTATGATGGGATTTgctataaatgtgtcac
catatttttcataaaaaataatcaccatgt

CDS

1128 bp

>Os01t0372500-00 Similar to Leucoanthocyanidin dioxygenase (EC 1.14.11.19) (LDOX) (Leucocyanidin oxygenase) (Leucoanthocyanidin hydroxylase).
ATGACGGATGTGGAGCTGAGAGTGGAGGCCCTCAGCCTCAGCGGCGTCTCCGCCATCCCG
CCGGAGTACGTCCGCCCGGAGGAGGAgcgcgccgacctcggcgacgccctggagctcgcc
cgggccgcgtccgacgacgacgccaccgcccgcatccccgtcgtcgacatctccgcgttc
gacaacgacggcgacggcaggcacgcgtgcgtggagGCGGTGCGCGCGGCGGCGGAGGAG
TGGGGCGTCATACACATCGCCGGCCACGGCCTCCCGGGCGACGTCCTCGGCCGCCTGCGC
GCCGCGGGCGAGGCGTTCTTCGCGCTGCCCATCGCGGAGAAGGAGGCGTACGCCAACGAC
CCGGCGGCGGGGCGGCTGCAGGGGTACGGCAGCAAGCTCGCCGCCAACGCCAGCGGGAAG
AGGGAGTGGGAGGACTACCTGTTCCACCTCGTCCACCCGGACCACCTCGCCGACCACTCG
CTCTGGCCGGCGAACCCGCCGGAGTACGTCCCCGTGTCGCGCGACTTCGGCGGCCGCGTC
CGGACCCTCGCATCCAAGCTGCTCGCCATCCTCTCCCTCGGCCTCGGCCTGCCGGAAGAG
ACGCTGGAACGCCGCCTGAGAGGACATGAGCTGGCCGGCGTCGACGACGACCTGCTCCTT
CAGCTCAAGATCAACTACTACCCGAGGTGCCCGCGGCCTGACCTCGCCGTCGGCGTCGAG
GCACACACCGACGTCAGCGCGCTCTCCTTCATCCTCCACAACGGCGTGCCGGGGCTGCAG
GTGCACCACGCCGGGAGCTGGGTCACCGCGCGCCCCGAGCCGGGCACCATCGTCGTCCAC
GTCGGCGACGCCCTGGAGATCCTCACCAACGGCCGGTACACCAGCGTGCTCCACCGCGGC
CTCGTCAGCCGCGACGCCGTGCGCCTCTCCTGGGTCGTCTTCTGCGAGCCGCCGCCTGAG
TCCGTGCTGCTGCAGCCGGTGCCGGAGCTGCTCGCCGACGGCGCCGACAAGCCGCTCTTC
GCGCCGCGCACATTCAAGCAGCACGTGCAACGCAAGCTGTTCGAGAAGCTCAAGGATCAG
CAAGACAACAATGCCGCAGCTGCATCGAACGGAATGAGAACTAAATAA

Protein

376 aa

>Os01t0372500-00 Similar to Leucoanthocyanidin dioxygenase (EC 1.14.11.19) (LDOX) (Leucocyanidin oxygenase) (Leucoanthocyanidin hydroxylase).
MTDVELRVEALSLSGVSAIPPEYVRPEEERADLGDALELARAASDDDATARIPVVDISAF
DNDGDGRHACVEAVRAAAEEWGVIHIAGHGLPGDVLGRLRAAGEAFFALPIAEKEAYAND
PAAGRLQGYGSKLAANASGKREWEDYLFHLVHPDHLADHSLWPANPPEYVPVSRDFGGRV
RTLASKLLAILSLGLGLPEETLERRLRGHELAGVDDDLLLQLKINYYPRCPRPDLAVGVE
AHTDVSALSFILHNGVPGLQVHHAGSWVTARPEPGTIVVHVGDALEILTNGRYTSVLHRG
LVSRDAVRLSWVVFCEPPPESVLLQPVPELLADGADKPLFAPRTFKQHVQRKLFEKLKDQ
QDNNAAAASNGMRTK*

5'UTR

chr01:15347890..15347941 (- strand) : 52 bp

CDS

chr01:15346762..15347889 (- strand) : 1128 bp

3'UTR

chr01:15346352..15346761 (- strand) : 410 bp

FASTA

>Os01t0372500-00 class=Sequence position=chr01:15346352..15347941 (- strand)
ATCGAGTACG TGCGCACGCA GCTCATCTAC TAGCCTACTT CGGGAGGGCG ACATGACGGA TGTGGAGCTG AGAGTGGAGG
CCCTCAGCCT CAGCGGCGTC TCCGCCATCC CGCCGGAGTA CGTCCGCCCG GAGGAGGAgc gcgccgacct cggcgacgcc
ctggagctcg cccgggccgc gtccgacgac gacgccaccg cccgcatccc cgtcgtcgac atctccgcgt tcgacaacga
cggcgacggc aggcacgcgt gcgtggagGC GGTGCGCGCG GCGGCGGAGG AGTGGGGCGT CATACACATC GCCGGCCACG
GCCTCCCGGG CGACGTCCTC GGCCGCCTGC GCGCCGCGGG CGAGGCGTTC TTCGCGCTGC CCATCGCGGA GAAGGAGGCG
TACGCCAACG ACCCGGCGGC GGGGCGGCTG CAGGGGTACG GCAGCAAGCT CGCCGCCAAC GCCAGCGGGA AGAGGGAGTG
GGAGGACTAC CTGTTCCACC TCGTCCACCC GGACCACCTC GCCGACCACT CGCTCTGGCC GGCGAACCCG CCGGAGTACG
TCCCCGTGTC GCGCGACTTC GGCGGCCGCG TCCGGACCCT CGCATCCAAG CTGCTCGCCA TCCTCTCCCT CGGCCTCGGC
CTGCCGGAAG AGACGCTGGA ACGCCGCCTG AGAGGACATG AGCTGGCCGG CGTCGACGAC GACCTGCTCC TTCAGCTCAA
GATCAACTAC TACCCGAGGT GCCCGCGGCC TGACCTCGCC GTCGGCGTCG AGGCACACAC CGACGTCAGC GCGCTCTCCT
TCATCCTCCA CAACGGCGTG CCGGGGCTGC AGGTGCACCA CGCCGGGAGC TGGGTCACCG CGCGCCCCGA GCCGGGCACC
ATCGTCGTCC ACGTCGGCGA CGCCCTGGAG ATCCTCACCA ACGGCCGGTA CACCAGCGTG CTCCACCGCG GCCTCGTCAG
CCGCGACGCC GTGCGCCTCT CCTGGGTCGT CTTCTGCGAG CCGCCGCCTG AGTCCGTGCT GCTGCAGCCG GTGCCGGAGC
TGCTCGCCGA CGGCGCCGAC AAGCCGCTCT TCGCGCCGCG CACATTCAAG CAGCACGTGC AACGCAAGCT GTTCGAGAAG
CTCAAGGATC AGCAAGACAA CAATGCCGCA GCTGCATCGA ACGGAATGAG AACTAAATAA TTGCAATTAG TCGATCTATC
GGCTAGACAA CCCAATATTT TGAAAAATTG ATGGACACAC AAAAAAAACT TTTTTATATA AGAATATGCA TTTGGTTGAT
TCAACATGAA AAATATTTTC AAACCATTAT ATTTTTAATT GGTTATGAAT AAACTATAAA AATAATTGCA TTCGTCTGAA
TTTCAGATAA AGGAGAACAA ATAATGTTCA ACGGAAGCGA AAGCCGGGGA AATGTACGGA TGTTATATCG AGAGCTTAAC
TTATGAGATG TCTTATATTT TGTTGTCTAT GTATTGCAGT CGACTTGTAC ACCGAGTCTT TCCATCCCTA TTAAGAGCTG
GAGCTCAATA TTATGATGGG ATTTgctata aatgtgtcac catatttttc ataaaaaata atcaccatgt 

Locus: Os01g0372500

Loading...

Locus: Os01g0372500

Loading...