Os01t0375100-01

Locus

Os01g0375100

Description

Similar to DnAJ-like protein slr0093.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsDjC6

Oryzabase Gene Name Synonym(s)

DnaJ domain protein C6

Transcript Evidence

AK102596 (DDBJ, Best hit)

Protein Evidence

A2ZTB1 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein folding (GO:0006457)

Molecular Function: heat shock protein binding (GO:0031072)

Molecular Function: unfolded protein binding (GO:0051082)

Functional domain (InterPro)

Heat shock protein DnaJ, N-terminal (IPR001623)

Heat shock protein DnaJ (IPR003095)

Domain of unknown function DUF3444 (IPR024593)

Full-length cDNA

J033098J19 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0375100-01)

RiceXPro (AK102596)

Others

Oryzabase (12163)

KEGG (Os01t0375100-01)

Transcript

3858 bp

>Os01t0375100-01 Similar to DnAJ-like protein slr0093.
GGCCTCGGCCTCCCGTCTCCTCGGCTCCTCGCCCACTTCGTCCGCCGCCTGCGCTGCGCC
GAGACGCCGCCGATCCCCATCCCGCGAGCGGCGGGGCCGGCCTCCATCCCGTGACCGCGA
GCAGGAGCGCCGGCGCGGGGCACGTGCTGCTGCTTCCACCAATATCATCGCCGGTGAGGG
CACCCGatctggaagcctttttctctttgccctaaccaatagaagttcgtttccaaatca
agattttgggggttcaagtaaacccccatgcccaacgtaagAACTTGTTAAGCCATAGGC
TCTGGTTCCATATGAGAGAAGATCCATATGCTCTTTTGAGATAGTTTGGAAAATGGCATC
AAAGAAAGTATAAGTGGGTTATGTCAAGAAGGCCTGTGATTTTCTAGAATCAATTTGGTG
AGCCGAATGATGGAGTGCAACAAAGAAGAGGCCCTCAAGGCCAGGGATATTGCTGCAAAG
AAGATGGAAAGCAAAGACTTTGTTGGTGCCAAAAGGATCGCGCTTAAAGCTCAAAGGATT
TTTCCAGAGCTTGAGAACATATCCCAGATGTTAACTGTCTGTGAAGTACATTGTGCGGCA
GAAGCAAAGATGAATGGACTATTGGACTTCTATGGAGTTCTCCAAGTGGATGTAATGGCG
GATGAAGCAACCATTAAAAAGCAATTCCGCAAGCTTGCTTTTTCGCTTCACCCTGATAAA
AACGGTTTCGCTGGCGCTGAAGCTGCTTTCAAATTAGTTGCAGAAGCTCAGTCAACATTG
TCTGATCGAACAAAACGGCGTGCATATGACATCAAATGGAGAATTGCATCAAAGCAGGCT
ACGCAACCAAAGCAGGGTGCCCAACCAGCGCAGGCTGCCCAACCAAAACAGTGTACACAA
CCACCGCTGGCTACAAAACGAAATCAGAGTGCACAACCAACGCATAATACACAGCAGAGT
GCACAGCCAAAGCAGAGTACACAACCGATGCAGGCTACTCAACCGAAGCATGCTACTGAA
CCAATGGAGAAAACAGATGCAAATAGAGCTAGTAATGCTAAGGAAGGATATGGATCATCA
GTTCGACCACCCAGTGCTGGAGAAGCATTCTGGACAATGTGTGTTAACTGTAAAACTAAA
TATCAGTACTACTCCAATGTTCTGAATCATAAACTCCGTTGTCAGAACTGCAAAAAAGAT
TTTCGAGCAGTTATGCTAAATGAACAGGATGTGCCTTCTGTATTCTCATCAAGTGCAGCC
AAAAGTGCAGGACAACATTGTGACGTTCCCAAACAAGAGGACTGTTCTACGAAGTTCTCT
TCTGCAGCGAATAGAGATGCAAAGCCCATGGTGAATGGAGGACAACATGATGAACAAATG
AAAAACAGTGCCAGTGTCAGAGCAGGTGGTGAGGGGACAGTTAACCATACAGAGTCAATC
AGAAAAGGGGGACTTGAATTTTCAACACTGCATGTATCTTCTGCAGCAAATGTTGGTAGT
AAGGCAGGGGGAAAGATGACATCGTGCCCTACTCCAGATGTTGCTGGTAGACAAAACCCT
GGTAATAGGGTAAATACATCAGCAGAGACAGGTGTGATGAATATTCCTAATCCACGGAGA
TCGGCTAGGAGGAAGGAAAATGCTGATGCCAGCATCATCCAGGATACGCCTAGCAAAAAG
AGGCGAACCATATTAGATTGGTTTTCAAATCCTGACTCAAGTCGTAAGAAAGTGGCTGAT
GATAATGTTGTCCGTGCTGATGGACAAGCTTGTGAACCTCATGTCTCCAGCGAAGCACAC
AACCACCAGAAAGGAACTACTAGCAATGAAGGAAACCAGGAAAAAAGGAAAGATGTTGCA
CATGATACAAATGCTCAGAAGAAATCTGGCATTCCTGGGAACTTTTCCTATCCTGACCCA
GAATTTTTTGACTTCGATAGGTGCAGGGATGTTAGTATGTTTGCAGTTGATCAGATCTGG
GCACTTTATGATGACCGTGATGGCATGCCACGATATTATGCTCGTATAAGACGCATTGAT
ACAACCAACTTCAGAGTTCAGTTCACTTGGCTGGAGCATGATGCAAAGAATGAGGAAGAG
GACAAATGGACTGATGAAGAATTGCCTGTGGCTTGTGGGAACTTTTTCTTAGGAAAAACA
GTGGTGTCACAAGATGCCCTCATGTTTTCTCATATTGTGTCATGGGTGAAAGGTAGAAAA
AGGAGCTCATACGAAATATATCCTAGGAAGGGTGAGGTATGGGCTCTATATAAGGGTTGG
AGTATGCAGTGGAgctcagatgcagataagcatagagcctatgagtatgaagctgtgGAG
ATCTTGTCAAATTTCACAGTGGAAGCTGGTGCTGCTGTTGGCCCTTTGGTAAAGATTAAA
GGTTTTGTGAGTCTCTTTGCAAAAGTAAAGGAGAAACCATCATTCGTTATACCACCAAGC
GAAATGCTACGGTTCTCTCACAGTATCCCATTTTTTAGAACAAAGGGAGATGAGAAGGTA
GGTGTTGCTGGTGGGTTTCTTGAACTAGATACTGCATCACTTCCTAGTAACTTGGACGTA
GCCTTTCCATCGGTTACTCTTGATTCTTGCATGCCTGTCTGCAAGACAATGAACAGTGGA
TTTAATGATTTCACTGGATATGAGCAAGGTGCGCTGAAAGAAAATTTGATGAACGAAGGT
AAACGTAAAGATCATTCCCTTGAACGAACCCCAGTGCATCAACAGAGTGCTGCCTATTCC
TCCCCCAGTACTTTTGATTACCCAAACTCTGAATTTCATAACTTTGAAGAATATCGATCA
TATAGTAAGTTTGAACGTGGCCAGATATGGGCTCTTTACAGTGATCTTGATCAATTTCCA
AAGTACTATGGTTGGGTGACCAAAGTTGATACAGATCCGTTCAGAGTGCATTTGACTTGG
CTCGAAGTCTGCCCTCAGCTGGAGCAGGAGAATATGTGGTTAGAGCAGAATATTCCTGTG
AGCTGTGGGACTTTTAAAATCCGCAACTGGAGGATAAAGTTAGACACGAATGATGCTTTC
TCTCATTTAGTAGAAACTAGCCAAGTTGGTTGGAAACGATACTTTGAAATTCATCCACAA
GTAGGGGAAATTTGGGCCATCTACAATAATTGGGCACCTGGTTGGGTTCCTTCCAGCAAG
GATACTTTCGAGTACACAATTGGTGAAATTACTGACTGCACTGAAGCTAGCACAAAAGTC
TTACTTTTGACCCGAGTAGATGGCTACAGAGCTGTGTTCAAGCCTGACAGTGTAAGGGGC
ACTCTGGAGATACCTACAAATGAAAACATAAGGTTTTCTCACCTGATACCTTCTTTCCGG
CTGACAAAAGAAAACGGTGGCAAACTCTGTGGCTTTTATGAGCTGGATCCAGCTTCTGTT
CCTGATACTTTCCTGTTCCGGAGCGGCCGCTGATTGGCAAATGTTGATGCTGACTGTCCT
GGAGATAGTAAGGATCTGGTCTCTTGTATGCTCTTCTAGTAGGGTGTTCATACACCACGC
AGCTGTGGTGCAAACCAAACCATGCTATCTTTTCTAATGTTGAGGCCTCTGTGCTCATTC
AGTTAGTTATTAGGTTAAAATTGCATGTTGCATTGGCATTTGGCATGTGATGCAGTGATT
ATCTGGTTGTCAATTTCTCTTGAGGCGTTGCCCTGAGAGCAAATGGGAAATGTCATGCAT
ACTGCAATTTTTCTGGAGCCAAGCTTCTTTTCTGGCCAGTGGTGTCATGGGCCTGTGCTC
AAAGAAGTATTGCAACCTGTAACATATAGGTTGCTTCTTGCTGTGCTTTAATATATTTGT
GCCCTTTCATTTGGTAGG

CDS

3027 bp

>Os01t0375100-01 Similar to DnAJ-like protein slr0093.
ATGATGGAGTGCAACAAAGAAGAGGCCCTCAAGGCCAGGGATATTGCTGCAAAGAAGATG
GAAAGCAAAGACTTTGTTGGTGCCAAAAGGATCGCGCTTAAAGCTCAAAGGATTTTTCCA
GAGCTTGAGAACATATCCCAGATGTTAACTGTCTGTGAAGTACATTGTGCGGCAGAAGCA
AAGATGAATGGACTATTGGACTTCTATGGAGTTCTCCAAGTGGATGTAATGGCGGATGAA
GCAACCATTAAAAAGCAATTCCGCAAGCTTGCTTTTTCGCTTCACCCTGATAAAAACGGT
TTCGCTGGCGCTGAAGCTGCTTTCAAATTAGTTGCAGAAGCTCAGTCAACATTGTCTGAT
CGAACAAAACGGCGTGCATATGACATCAAATGGAGAATTGCATCAAAGCAGGCTACGCAA
CCAAAGCAGGGTGCCCAACCAGCGCAGGCTGCCCAACCAAAACAGTGTACACAACCACCG
CTGGCTACAAAACGAAATCAGAGTGCACAACCAACGCATAATACACAGCAGAGTGCACAG
CCAAAGCAGAGTACACAACCGATGCAGGCTACTCAACCGAAGCATGCTACTGAACCAATG
GAGAAAACAGATGCAAATAGAGCTAGTAATGCTAAGGAAGGATATGGATCATCAGTTCGA
CCACCCAGTGCTGGAGAAGCATTCTGGACAATGTGTGTTAACTGTAAAACTAAATATCAG
TACTACTCCAATGTTCTGAATCATAAACTCCGTTGTCAGAACTGCAAAAAAGATTTTCGA
GCAGTTATGCTAAATGAACAGGATGTGCCTTCTGTATTCTCATCAAGTGCAGCCAAAAGT
GCAGGACAACATTGTGACGTTCCCAAACAAGAGGACTGTTCTACGAAGTTCTCTTCTGCA
GCGAATAGAGATGCAAAGCCCATGGTGAATGGAGGACAACATGATGAACAAATGAAAAAC
AGTGCCAGTGTCAGAGCAGGTGGTGAGGGGACAGTTAACCATACAGAGTCAATCAGAAAA
GGGGGACTTGAATTTTCAACACTGCATGTATCTTCTGCAGCAAATGTTGGTAGTAAGGCA
GGGGGAAAGATGACATCGTGCCCTACTCCAGATGTTGCTGGTAGACAAAACCCTGGTAAT
AGGGTAAATACATCAGCAGAGACAGGTGTGATGAATATTCCTAATCCACGGAGATCGGCT
AGGAGGAAGGAAAATGCTGATGCCAGCATCATCCAGGATACGCCTAGCAAAAAGAGGCGA
ACCATATTAGATTGGTTTTCAAATCCTGACTCAAGTCGTAAGAAAGTGGCTGATGATAAT
GTTGTCCGTGCTGATGGACAAGCTTGTGAACCTCATGTCTCCAGCGAAGCACACAACCAC
CAGAAAGGAACTACTAGCAATGAAGGAAACCAGGAAAAAAGGAAAGATGTTGCACATGAT
ACAAATGCTCAGAAGAAATCTGGCATTCCTGGGAACTTTTCCTATCCTGACCCAGAATTT
TTTGACTTCGATAGGTGCAGGGATGTTAGTATGTTTGCAGTTGATCAGATCTGGGCACTT
TATGATGACCGTGATGGCATGCCACGATATTATGCTCGTATAAGACGCATTGATACAACC
AACTTCAGAGTTCAGTTCACTTGGCTGGAGCATGATGCAAAGAATGAGGAAGAGGACAAA
TGGACTGATGAAGAATTGCCTGTGGCTTGTGGGAACTTTTTCTTAGGAAAAACAGTGGTG
TCACAAGATGCCCTCATGTTTTCTCATATTGTGTCATGGGTGAAAGGTAGAAAAAGGAGC
TCATACGAAATATATCCTAGGAAGGGTGAGGTATGGGCTCTATATAAGGGTTGGAGTATG
CAGTGGAgctcagatgcagataagcatagagcctatgagtatgaagctgtgGAGATCTTG
TCAAATTTCACAGTGGAAGCTGGTGCTGCTGTTGGCCCTTTGGTAAAGATTAAAGGTTTT
GTGAGTCTCTTTGCAAAAGTAAAGGAGAAACCATCATTCGTTATACCACCAAGCGAAATG
CTACGGTTCTCTCACAGTATCCCATTTTTTAGAACAAAGGGAGATGAGAAGGTAGGTGTT
GCTGGTGGGTTTCTTGAACTAGATACTGCATCACTTCCTAGTAACTTGGACGTAGCCTTT
CCATCGGTTACTCTTGATTCTTGCATGCCTGTCTGCAAGACAATGAACAGTGGATTTAAT
GATTTCACTGGATATGAGCAAGGTGCGCTGAAAGAAAATTTGATGAACGAAGGTAAACGT
AAAGATCATTCCCTTGAACGAACCCCAGTGCATCAACAGAGTGCTGCCTATTCCTCCCCC
AGTACTTTTGATTACCCAAACTCTGAATTTCATAACTTTGAAGAATATCGATCATATAGT
AAGTTTGAACGTGGCCAGATATGGGCTCTTTACAGTGATCTTGATCAATTTCCAAAGTAC
TATGGTTGGGTGACCAAAGTTGATACAGATCCGTTCAGAGTGCATTTGACTTGGCTCGAA
GTCTGCCCTCAGCTGGAGCAGGAGAATATGTGGTTAGAGCAGAATATTCCTGTGAGCTGT
GGGACTTTTAAAATCCGCAACTGGAGGATAAAGTTAGACACGAATGATGCTTTCTCTCAT
TTAGTAGAAACTAGCCAAGTTGGTTGGAAACGATACTTTGAAATTCATCCACAAGTAGGG
GAAATTTGGGCCATCTACAATAATTGGGCACCTGGTTGGGTTCCTTCCAGCAAGGATACT
TTCGAGTACACAATTGGTGAAATTACTGACTGCACTGAAGCTAGCACAAAAGTCTTACTT
TTGACCCGAGTAGATGGCTACAGAGCTGTGTTCAAGCCTGACAGTGTAAGGGGCACTCTG
GAGATACCTACAAATGAAAACATAAGGTTTTCTCACCTGATACCTTCTTTCCGGCTGACA
AAAGAAAACGGTGGCAAACTCTGTGGCTTTTATGAGCTGGATCCAGCTTCTGTTCCTGAT
ACTTTCCTGTTCCGGAGCGGCCGCTGA

Protein

1009 aa

>Os01t0375100-01 Similar to DnAJ-like protein slr0093.
MMECNKEEALKARDIAAKKMESKDFVGAKRIALKAQRIFPELENISQMLTVCEVHCAAEA
KMNGLLDFYGVLQVDVMADEATIKKQFRKLAFSLHPDKNGFAGAEAAFKLVAEAQSTLSD
RTKRRAYDIKWRIASKQATQPKQGAQPAQAAQPKQCTQPPLATKRNQSAQPTHNTQQSAQ
PKQSTQPMQATQPKHATEPMEKTDANRASNAKEGYGSSVRPPSAGEAFWTMCVNCKTKYQ
YYSNVLNHKLRCQNCKKDFRAVMLNEQDVPSVFSSSAAKSAGQHCDVPKQEDCSTKFSSA
ANRDAKPMVNGGQHDEQMKNSASVRAGGEGTVNHTESIRKGGLEFSTLHVSSAANVGSKA
GGKMTSCPTPDVAGRQNPGNRVNTSAETGVMNIPNPRRSARRKENADASIIQDTPSKKRR
TILDWFSNPDSSRKKVADDNVVRADGQACEPHVSSEAHNHQKGTTSNEGNQEKRKDVAHD
TNAQKKSGIPGNFSYPDPEFFDFDRCRDVSMFAVDQIWALYDDRDGMPRYYARIRRIDTT
NFRVQFTWLEHDAKNEEEDKWTDEELPVACGNFFLGKTVVSQDALMFSHIVSWVKGRKRS
SYEIYPRKGEVWALYKGWSMQWSSDADKHRAYEYEAVEILSNFTVEAGAAVGPLVKIKGF
VSLFAKVKEKPSFVIPPSEMLRFSHSIPFFRTKGDEKVGVAGGFLELDTASLPSNLDVAF
PSVTLDSCMPVCKTMNSGFNDFTGYEQGALKENLMNEGKRKDHSLERTPVHQQSAAYSSP
STFDYPNSEFHNFEEYRSYSKFERGQIWALYSDLDQFPKYYGWVTKVDTDPFRVHLTWLE
VCPQLEQENMWLEQNIPVSCGTFKIRNWRIKLDTNDAFSHLVETSQVGWKRYFEIHPQVG
EIWAIYNNWAPGWVPSSKDTFEYTIGEITDCTEASTKVLLLTRVDGYRAVFKPDSVRGTL
EIPTNENIRFSHLIPSFRLTKENGGKLCGFYELDPASVPDTFLFRSGR*

5'UTR

chr01:15478137..15478322 (- strand) : 186 bp

chr01:15477967..15478061 (- strand) : 95 bp

chr01:15477716..15477860 (- strand) : 145 bp

CDS

chr01:15474689..15477715 (- strand) : 3027 bp

3'UTR

chr01:15474284..15474688 (- strand) : 405 bp

FASTA

>Os01t0375100-01 class=Sequence position=chr01:15474284..15478322 (- strand)
GGCCTCGGCC TCCCGTCTCC TCGGCTCCTC GCCCACTTCG TCCGCCGCCT GCGCTGCGCC GAGACGCCGC CGATCCCCAT
CCCGCGAGCG GCGGGGCCGG CCTCCATCCC GTGACCGCGA GCAGGAGCGC CGGCGCGGGG CACGTGCTGC TGCTTCCACC
AATATCATCG CCGGTGAGGG CACCCGGTAC GGAAatcctc ttcctcattt atctctaccc acacgctctc tctttgccct
taaccttggc ttctcttgta gatctggaag cctttttctc tttgccctaa ccaatagaag ttcgtttcca aatcaagatt
ttgggggttc aagtaaaccc ccatgcccaa cgtaaggtcc gcccctAAAT TACCATGACC GCATATTTTC ACTGTTTTGC
ATTTGTACCT ATAGCCTGTG GTTTTCTATT TACATTACTT TCTTTTTTTT ACAAATTTGC AGAACTTGTT AAGCCATAGG
CTCTGGTTCC ATATGAGAGA AGATCCATAT GCTCTTTTGA GATAGTTTGG AAAATGGCAT CAAAGAAAGT ATAAGTGGGT
TATGTCAAGA AGGCCTGTGA TTTTCTAGAA TCAATTTGGT GAGCCGAATG ATGGAGTGCA ACAAAGAAGA GGCCCTCAAG
GCCAGGGATA TTGCTGCAAA GAAGATGGAA AGCAAAGACT TTGTTGGTGC CAAAAGGATC GCGCTTAAAG CTCAAAGGAT
TTTTCCAGAG CTTGAGAACA TATCCCAGAT GTTAACTGTC TGTGAAGTAC ATTGTGCGGC AGAAGCAAAG ATGAATGGAC
TATTGGACTT CTATGGAGTT CTCCAAGTGG ATGTAATGGC GGATGAAGCA ACCATTAAAA AGCAATTCCG CAAGCTTGCT
TTTTCGCTTC ACCCTGATAA AAACGGTTTC GCTGGCGCTG AAGCTGCTTT CAAATTAGTT GCAGAAGCTC AGTCAACATT
GTCTGATCGA ACAAAACGGC GTGCATATGA CATCAAATGG AGAATTGCAT CAAAGCAGGC TACGCAACCA AAGCAGGGTG
CCCAACCAGC GCAGGCTGCC CAACCAAAAC AGTGTACACA ACCACCGCTG GCTACAAAAC GAAATCAGAG TGCACAACCA
ACGCATAATA CACAGCAGAG TGCACAGCCA AAGCAGAGTA CACAACCGAT GCAGGCTACT CAACCGAAGC ATGCTACTGA
ACCAATGGAG AAAACAGATG CAAATAGAGC TAGTAATGCT AAGGAAGGAT ATGGATCATC AGTTCGACCA CCCAGTGCTG
GAGAAGCATT CTGGACAATG TGTGTTAACT GTAAAACTAA ATATCAGTAC TACTCCAATG TTCTGAATCA TAAACTCCGT
TGTCAGAACT GCAAAAAAGA TTTTCGAGCA GTTATGCTAA ATGAACAGGA TGTGCCTTCT GTATTCTCAT CAAGTGCAGC
CAAAAGTGCA GGACAACATT GTGACGTTCC CAAACAAGAG GACTGTTCTA CGAAGTTCTC TTCTGCAGCG AATAGAGATG
CAAAGCCCAT GGTGAATGGA GGACAACATG ATGAACAAAT GAAAAACAGT GCCAGTGTCA GAGCAGGTGG TGAGGGGACA
GTTAACCATA CAGAGTCAAT CAGAAAAGGG GGACTTGAAT TTTCAACACT GCATGTATCT TCTGCAGCAA ATGTTGGTAG
TAAGGCAGGG GGAAAGATGA CATCGTGCCC TACTCCAGAT GTTGCTGGTA GACAAAACCC TGGTAATAGG GTAAATACAT
CAGCAGAGAC AGGTGTGATG AATATTCCTA ATCCACGGAG ATCGGCTAGG AGGAAGGAAA ATGCTGATGC CAGCATCATC
CAGGATACGC CTAGCAAAAA GAGGCGAACC ATATTAGATT GGTTTTCAAA TCCTGACTCA AGTCGTAAGA AAGTGGCTGA
TGATAATGTT GTCCGTGCTG ATGGACAAGC TTGTGAACCT CATGTCTCCA GCGAAGCACA CAACCACCAG AAAGGAACTA
CTAGCAATGA AGGAAACCAG GAAAAAAGGA AAGATGTTGC ACATGATACA AATGCTCAGA AGAAATCTGG CATTCCTGGG
AACTTTTCCT ATCCTGACCC AGAATTTTTT GACTTCGATA GGTGCAGGGA TGTTAGTATG TTTGCAGTTG ATCAGATCTG
GGCACTTTAT GATGACCGTG ATGGCATGCC ACGATATTAT GCTCGTATAA GACGCATTGA TACAACCAAC TTCAGAGTTC
AGTTCACTTG GCTGGAGCAT GATGCAAAGA ATGAGGAAGA GGACAAATGG ACTGATGAAG AATTGCCTGT GGCTTGTGGG
AACTTTTTCT TAGGAAAAAC AGTGGTGTCA CAAGATGCCC TCATGTTTTC TCATATTGTG TCATGGGTGA AAGGTAGAAA
AAGGAGCTCA TACGAAATAT ATCCTAGGAA GGGTGAGGTA TGGGCTCTAT ATAAGGGTTG GAGTATGCAG TGGAgctcag
atgcagataa gcatagagcc tatgagtatg aagctgtgGA GATCTTGTCA AATTTCACAG TGGAAGCTGG TGCTGCTGTT
GGCCCTTTGG TAAAGATTAA AGGTTTTGTG AGTCTCTTTG CAAAAGTAAA GGAGAAACCA TCATTCGTTA TACCACCAAG
CGAAATGCTA CGGTTCTCTC ACAGTATCCC ATTTTTTAGA ACAAAGGGAG ATGAGAAGGT AGGTGTTGCT GGTGGGTTTC
TTGAACTAGA TACTGCATCA CTTCCTAGTA ACTTGGACGT AGCCTTTCCA TCGGTTACTC TTGATTCTTG CATGCCTGTC
TGCAAGACAA TGAACAGTGG ATTTAATGAT TTCACTGGAT ATGAGCAAGG TGCGCTGAAA GAAAATTTGA TGAACGAAGG
TAAACGTAAA GATCATTCCC TTGAACGAAC CCCAGTGCAT CAACAGAGTG CTGCCTATTC CTCCCCCAGT ACTTTTGATT
ACCCAAACTC TGAATTTCAT AACTTTGAAG AATATCGATC ATATAGTAAG TTTGAACGTG GCCAGATATG GGCTCTTTAC
AGTGATCTTG ATCAATTTCC AAAGTACTAT GGTTGGGTGA CCAAAGTTGA TACAGATCCG TTCAGAGTGC ATTTGACTTG
GCTCGAAGTC TGCCCTCAGC TGGAGCAGGA GAATATGTGG TTAGAGCAGA ATATTCCTGT GAGCTGTGGG ACTTTTAAAA
TCCGCAACTG GAGGATAAAG TTAGACACGA ATGATGCTTT CTCTCATTTA GTAGAAACTA GCCAAGTTGG TTGGAAACGA
TACTTTGAAA TTCATCCACA AGTAGGGGAA ATTTGGGCCA TCTACAATAA TTGGGCACCT GGTTGGGTTC CTTCCAGCAA
GGATACTTTC GAGTACACAA TTGGTGAAAT TACTGACTGC ACTGAAGCTA GCACAAAAGT CTTACTTTTG ACCCGAGTAG
ATGGCTACAG AGCTGTGTTC AAGCCTGACA GTGTAAGGGG CACTCTGGAG ATACCTACAA ATGAAAACAT AAGGTTTTCT
CACCTGATAC CTTCTTTCCG GCTGACAAAA GAAAACGGTG GCAAACTCTG TGGCTTTTAT GAGCTGGATC CAGCTTCTGT
TCCTGATACT TTCCTGTTCC GGAGCGGCCG CTGATTGGCA AATGTTGATG CTGACTGTCC TGGAGATAGT AAGGATCTGG
TCTCTTGTAT GCTCTTCTAG TAGGGTGTTC ATACACCACG CAGCTGTGGT GCAAACCAAA CCATGCTATC TTTTCTAATG
TTGAGGCCTC TGTGCTCATT CAGTTAGTTA TTAGGTTAAA ATTGCATGTT GCATTGGCAT TTGGCATGTG ATGCAGTGAT
TATCTGGTTG TCAATTTCTC TTGAGGCGTT GCCCTGAGAG CAAATGGGAA ATGTCATGCA TACTGCAATT TTTCTGGAGC
CAAGCTTCTT TTCTGGCCAG TGGTGTCATG GGCCTGTGCT CAAAGAAGTA TTGCAACCTG TAACATATAG GTTGCTTCTT
GCTGTGCTTT AATATATTTG TGCCCTTTCA TTTGGTAGG