Os01t0376700-01

Locus

Os01g0376700

Description

Similar to Sucrose-phosphatase (EC 3.1.3.24).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK071525 (DDBJ, Best hit)

Protein Evidence

B7E8F4 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: sucrose biosynthetic process (GO:0005986)

Biological Process: metabolic process (GO:0008152)

Molecular Function: magnesium ion binding (GO:0000287)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: phosphatase activity (GO:0016791)

Molecular Function: sucrose-phosphate phosphatase activity (GO:0050307)

Functional domain (InterPro)

Sucrose-phosphate phosphatase (IPR006378)

HAD-superfamily hydrolase, subfamily IIB (IPR006379)

Sucrose-phosphate synthase (IPR006380)

Sucrose phosphatase, plant/cyanobacteria (IPR012847)

Sucrose-6-phosphate phosphohydrolase C-terminal (IPR013679)

HAD-like domain (IPR023214)

Full-length cDNA

J023099K18 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0376700-01)

RiceXPro (AK071525)

Others

KEGG (Os01t0376700-01 (EC:3.1.3.24))

Transcript

1608 bp

>Os01t0376700-01 Similar to Sucrose-phosphatase (EC 3.1.3.24).
TCTCTTCTCCCGACTCCTGAGAGAAGAAGAACCGCTGCTTCTCCACCCGTCGCGGAGCCC
CGTGTCCATCCTCCGGCGCGGCGGCCGCCCCCCAGCGATCCGCCTCAGGTTGCTAAAATG
GATAAGCTCAGTGGTTCTGCACGTCTTATTATCGTTTCAGATCTTGACCACACGATGGTT
GATCATCACGATGAGGAGAACTTATCCTTGCTTAGATTTGGCGCCCTGTGGGAGTCCGTT
TACTGTCAGGATTCTCTACTAGTATTTTCAACTGGAAGATCCCCTACTCTTTATAAGGAA
TTGAGGAAAGAGAAGCCTATGCTAACTCCAGACATCACTATCATGTCTGTGGGGACTGAG
ATAACATATGGTGAGGCAATGGTTCCTGATGATGGTTGGGAGGAATATCTGAACAATAAG
TGGGACAGGAATGTAGTTGTGGAGGAGACAGCTAAGTTTTCTGAGCTGAAGCTTCAGGCA
CAGACAGAACAGCGTCCACATAAGGTCAGCTTTTTTGTTGATAAAAAGAGTGCTCAGGAA
GTGATAAAGTCTCTCTCCGGTAATATGGAGAAATGCGGGCTTGATGTTAAAATAATCTAC
AGTGGTGGCCAAGACCTTGACATATTACCTCAGGGCGCTGGGAAGGGTCAAGCACTTGCA
TATTTGCTTAAGAAGTTAAGCTCCTGTGGAAAACCACCAAACAATACTCTTGTTTGTGGG
GACTCTGGTAATGATGCAGAATTATTTAGCATCCCTGGTGTACATGGTGTCATGGTTAGC
AATGCCCAAGAGGAATTGCTTCAGTGGTATGCAGAAAATGCGAAGGGTAACCCTAAAATT
ATTCATGCAACTGAGAGGTGCGCCGCTGGTATTATCGAAGCTATTGGACACTTCAAACTA
GGACCTAGTGTTTCTCCAAGAGATGTGGGGTTTCCTTATGTTAAGGAGGACCATATCAAA
CCTACAGATGCTGTTGTAAAGTTTTACGTTCTCTATGAGAAGTGGCGCAGGGCTGAGGTT
CCAAAATCAGATTCAGTTGTACAGTACTTCAAAAATATCACTCATGCAAATGGTGTTATC
ATTCAACCTTCTGGGCTTGAATGTTCTCTCCATGCCTCTGTTGATGCATTGAGTTCATGT
TATGGTGAGAAACAAGGGAAAAAATACCGAACATGGGTGGACAGACTATTTGTCTCACAG
TCTGGTTCAGACAGTTGGCTGGTCAGATTTGACTTGTGGGAGGCAGAAGGTGATGCGCGG
TTGTGCTGTTTGACAAGTCTTGCGCTGAATGTAAAGCCTGAAACCCCTGCTGGCTTCCTG
ATAACACATGTACACAAAACATGGCTCAAAGGATACTCTTCAGCGGATGAGCAGTCCTCC
AAGCTTTAAACCCTTTTTCACCCCTGTGCACACGGAATGAATTTACTTGATGATAAATGA
AGGACCTGCTCGTCTGAGAATCTCATTTTCTTATTTAATGTAATATAAATGATCTGTCTC
GTGACTCGTGCGATGATAAAGTGAACGATCTCAGAAGGCAACTTCAACAAATGTTGGATA
TGATTTTACAGAGAGTTCAGAATTAGATTTCATGACACAAGTACCGCT

CDS

1272 bp

>Os01t0376700-01 Similar to Sucrose-phosphatase (EC 3.1.3.24).
ATGGATAAGCTCAGTGGTTCTGCACGTCTTATTATCGTTTCAGATCTTGACCACACGATG
GTTGATCATCACGATGAGGAGAACTTATCCTTGCTTAGATTTGGCGCCCTGTGGGAGTCC
GTTTACTGTCAGGATTCTCTACTAGTATTTTCAACTGGAAGATCCCCTACTCTTTATAAG
GAATTGAGGAAAGAGAAGCCTATGCTAACTCCAGACATCACTATCATGTCTGTGGGGACT
GAGATAACATATGGTGAGGCAATGGTTCCTGATGATGGTTGGGAGGAATATCTGAACAAT
AAGTGGGACAGGAATGTAGTTGTGGAGGAGACAGCTAAGTTTTCTGAGCTGAAGCTTCAG
GCACAGACAGAACAGCGTCCACATAAGGTCAGCTTTTTTGTTGATAAAAAGAGTGCTCAG
GAAGTGATAAAGTCTCTCTCCGGTAATATGGAGAAATGCGGGCTTGATGTTAAAATAATC
TACAGTGGTGGCCAAGACCTTGACATATTACCTCAGGGCGCTGGGAAGGGTCAAGCACTT
GCATATTTGCTTAAGAAGTTAAGCTCCTGTGGAAAACCACCAAACAATACTCTTGTTTGT
GGGGACTCTGGTAATGATGCAGAATTATTTAGCATCCCTGGTGTACATGGTGTCATGGTT
AGCAATGCCCAAGAGGAATTGCTTCAGTGGTATGCAGAAAATGCGAAGGGTAACCCTAAA
ATTATTCATGCAACTGAGAGGTGCGCCGCTGGTATTATCGAAGCTATTGGACACTTCAAA
CTAGGACCTAGTGTTTCTCCAAGAGATGTGGGGTTTCCTTATGTTAAGGAGGACCATATC
AAACCTACAGATGCTGTTGTAAAGTTTTACGTTCTCTATGAGAAGTGGCGCAGGGCTGAG
GTTCCAAAATCAGATTCAGTTGTACAGTACTTCAAAAATATCACTCATGCAAATGGTGTT
ATCATTCAACCTTCTGGGCTTGAATGTTCTCTCCATGCCTCTGTTGATGCATTGAGTTCA
TGTTATGGTGAGAAACAAGGGAAAAAATACCGAACATGGGTGGACAGACTATTTGTCTCA
CAGTCTGGTTCAGACAGTTGGCTGGTCAGATTTGACTTGTGGGAGGCAGAAGGTGATGCG
CGGTTGTGCTGTTTGACAAGTCTTGCGCTGAATGTAAAGCCTGAAACCCCTGCTGGCTTC
CTGATAACACATGTACACAAAACATGGCTCAAAGGATACTCTTCAGCGGATGAGCAGTCC
TCCAAGCTTTAA

Protein

424 aa

>Os01t0376700-01 Similar to Sucrose-phosphatase (EC 3.1.3.24).
MDKLSGSARLIIVSDLDHTMVDHHDEENLSLLRFGALWESVYCQDSLLVFSTGRSPTLYK
ELRKEKPMLTPDITIMSVGTEITYGEAMVPDDGWEEYLNNKWDRNVVVEETAKFSELKLQ
AQTEQRPHKVSFFVDKKSAQEVIKSLSGNMEKCGLDVKIIYSGGQDLDILPQGAGKGQAL
AYLLKKLSSCGKPPNNTLVCGDSGNDAELFSIPGVHGVMVSNAQEELLQWYAENAKGNPK
IIHATERCAAGIIEAIGHFKLGPSVSPRDVGFPYVKEDHIKPTDAVVKFYVLYEKWRRAE
VPKSDSVVQYFKNITHANGVIIQPSGLECSLHASVDALSSCYGEKQGKKYRTWVDRLFVS
QSGSDSWLVRFDLWEAEGDARLCCLTSLALNVKPETPAGFLITHVHKTWLKGYSSADEQS
SKL*

5'UTR

chr01:15573240..15573347 (- strand) : 108 bp

chr01:15572017..15572025 (- strand) : 9 bp

CDS

chr01:15571957..15572016 (- strand) : 60 bp

chr01:15571560..15571863 (- strand) : 304 bp

chr01:15571351..15571448 (- strand) : 98 bp

chr01:15571048..15571242 (- strand) : 195 bp

chr01:15570664..15570951 (- strand) : 288 bp

chr01:15570270..15570456 (- strand) : 187 bp

chr01:15569317..15569363 (- strand) : 47 bp

chr01:15569107..15569199 (- strand) : 93 bp

3'UTR

chr01:15568888..15569106 (- strand) : 219 bp

FASTA

>Os01t0376700-01 class=Sequence position=chr01:15568888..15573347 (- strand)
TCTCTTCTCC CGACTCCTGA GAGAAGAAGA ACCGCTGCTT CTCCACCCGT CGCGGAGCCC CGTGTCCATC CTCCGGCGCG
GCGGCCGCCC CCCAGCGATC CGCCTCAGGT GAGAGCACCG CCCGCACCCC CTACTGCTCT CCCCTCCCCT GGAGATCGGC
GTCCCACTCA CTCCCATCCC CCACCTCATC GGTGGATTGG ATTGGATACC AGTAGGGGGG CGATCGCTCA TCGCTGCTTG
TGTGCATTTC TTCTGGTAGG ATTGGGGGAT TTACTGCGTG ACCGTGGTGT GATATTATGT TCGTGTTCAG TGCATTGCTT
CTTCTTCCAG GAAGAGATAT CAACTCTCTT TTATTAATCG ACACGCGTCC TGTGTGTTCT TCTTTTTATC GCATCGTAAC
ATCGTTAATG ATGCAGGGTG GTTATCCGCG TTGTTAGAAG ATACTATATG GATTGTAAAA TCTATAGAGG ATTGTTTCAT
TTTCTTCTTA TTGTTGCTAA CATTAAGAAG ATGCTAGGAT AGGATCATAG GATGGTGTAG GTCGACACTG ACCACTGCAT
TGCTATTCGC GCAACGCCAA TCTTTTAGTA CTTCACTTCC TGCTTCACTC CTCTGTCAAA AGTCGATGCT TGGAATTAAA
TTCTTCTGGA AATTGGGAGC TTCTTCAAAG AATCGTGTTG TCCTGAATTT CTTTGTCCCG TTTGGCATTT TCCTTTTTTT
TTATATTGAA TGACTCAAGC CCATCTAGTG TAAGTGTGTA ACTGCGTGCT CTAACATTTT CAACTGAACC AGGGGATAGT
TTTCAAGTTT ATCACCTTGC CTTTGCTGGT TTAGCTGTAC CAAAAGATAA AAGGAACAAT TTCCAATGAA TTACATATAC
ATTTTGTTTA ACACCAAGTG AGCTTTATAT AATATTTATC AATAGACTTG AAGACTTATA TATATATTTG TTATACCCTA
TGCCTTATTC GAAACGAATC CAGTATGCTT TTTTGAGTAA TGGCCTGGAC TGCAAGTTGA TTTACTGTTT ATGACTATTA
CTATTCACAG TTAAAACTGC AAATTTATAG AGGTGTTAGG AAATGGAAGA AAGAAAATAA AAACAAACAG CTGTTTCCAT
GTCTCCTAGG AACTCTCAGT TGCTACCTAA AAAGCCAGGT GTTTCACTTG CTTGGTAAAA TGCCACCGCA CAATTTGGTA
CCACTGCTTA GGACCTGGCA CAGTTTGGCA CCGTTGCTTG GAACATAAAC AGAAGGTCTC TTTTTAGTGT TCTGCTCAAG
AGCTTTAAGA CCTCTCAAGC TCACAACCAT TATCATATGC AGGTTGCTAA AATGGATAAG CTCAGTGGTT CTGCACGTCT
TATTATCGTT TCAGATCTTG ACCACACGAT GGTTTGTGTT TTTCAACTCA TATCTTAGAC TTGTTCAGAG ATAATTGCAG
CCTGTTATAT GTCGTTTTAA TCCTTCTTCA ATTCAAACTT GCAGGTTGAT CATCACGATG AGGAGAACTT ATCCTTGCTT
AGATTTGGCG CCCTGTGGGA GTCCGTTTAC TGTCAGGATT CTCTACTAGT ATTTTCAACT GGAAGATCCC CTACTCTTTA
TAAGGAATTG AGGAAAGAGA AGCCTATGCT AACTCCAGAC ATCACTATCA TGTCTGTGGG GACTGAGATA ACATATGGTG
AGGCAATGGT TCCTGATGAT GGTTGGGAGG AATATCTGAA CAATAAGTGG GACAGGAATG TAGTTGTGGA GGAGACAGCT
AAGTTTTCTG AGCTGAAGCT TCAGGCACGT TCAATATTTC ACATCTGATT CTGTTAATCT ACAATTATTT CGAAAATCTG
ATGGCTAAAA TAACTAGTAA CATTGTTCTA TTGCCGTACA TTTGCATGGA TACAGCCAGA GACAGAACAG CGTCCACATA
AGGTCAGCTT TTTTGTTGAT AAAAAGAGTG CTCAGGAAGT GATAAAGTCT CTCTCCGGTA ATATGGAGAA ATGCGGGGTG
AGGCAACATT CGACTTGATG TTAGCTTGTT TCAATTTTGG ATAACTTAAG AACTATTTAT GGTTTCTTTT CGTATTATGT
TAACTGCTAT ATTTCTTGTA AACAGCTTGA TGTTAAAATA ATCTACAGTG GTGGCCAAGA CCTTGACATA TTACCTCAGG
GCGCTGGGAA GGGTCAAGCA CTTGCATATT TGCTTAAGAA GTTAAGCTCC TGTGGAAAAC CACCAAACAA TACTCTTGTT
TGTGGGGACT CTGGTAATGA TGCAGAATTA TTTAGCATCC CTGGTGTACA TGGTGTCATG GTCAGTATAC AATAAATTTC
ATGAAGTGTC TAACAAAGTT CATGCCAGAT TGAATATAAG TTTACTGTAA CTGCAATCTT TTTTTAAATT TTTCAGGTTA
GCAATGCCCA AGAGGAATTG CTTCAGTGGT ATGCAGAAAA TGCGAAGGGT AACCCTAAAA TTATTCATGC AACTGAGAGG
TGCGCCGCTG GTATTATCGA AGCTATTGGA CACTTCAAAC TAGGACCTAG TGTTTCTCCA AGAGATGTGG GGTTTCCTTA
TGTTAAGGAG GACCATATCA AACCTACAGA TGCTGTTGTA AAGTTTTACG TTCTCTATGA GAAGTGGCGC AGGGCTGAGG
TTCCAAAATC AGATTCAGTT GTACAGTACT TCAAAAATAT CACTGTAAGT ACATCACTGC CCAGTGTGAT GTTTCTTCAA
AATAATTTGT AACCTTTGTC AAAATCAGTT TTATCTTTTA CCTCAAAAGA AATTATCAGA ACCTTCTAAT TTTGGAAAAG
AAGTTATATT TCCAATTAAT AAAGTGAACT GGGTCTGACG TATTATATTG TTGAGTTAAC TGATTTTTTA TTTGTTTTTG
GTTTGTCTTA GCATGCAAAT GGTGTTATCA TTCAACCTTC TGGGCTTGAA TGTTCTCTCC ATGCCTCTGT TGATGCATTG
AGTTCATGTT ATGGTGAGAA ACAAGGGAAA AAATACCGAA CATGGGTGGA CAGACTATTT GTCTCACAGT CTGGTTCAGA
CAGTTGGCTG GTCAGATTTG ACTTGTGGGA GGCAGAAGGT TAGTCCTTAG AATTGTGTAG AATGAGTGAA TTAGCTCTTA
TATGATATTT TTTACACTTC ATTCAAATTT CTTTAATGTT TTACTTACAC AATTTAGCTT GTTCAATCAT ATTTTTTCAC
TTGTAGGTTT CTCTAGACAT GTCACTTCAA TCTATTAATT TTGTTGTGTG TTGTAGTATA TCCTCGTACA CACCAGAAAT
TATATGAAGG TTTTAGGCAA TAGTTTATGA AAAGATTGAC AACATATTCA ACTCTGCATC TGTACGTACA AATGTCATAA
TACATTACAC ATATGCAGTC TAGTGCAATT CATTTGTAAA TAAAAGTAAG AAAACATACT CCTCAATAAA AAATAATTTA
TTTTATATAC GATTTAAATT GGACCAAAGC CAAGAAGAGA ACCAGCTGTC TCGGCTAGGG ACAAAGAAGA CCCTGCAAGT
ACACCCAATG AATATAAATG ATTAAAATAT GTCCAAAGTT GTAGAAGACC GGCATCAATG ATAATACATT CTTTGGAGTC
TACATTTTTC AAAGTACGAA ACTTTGGAGT GGCAAACACA CATGAAACTC TAATATTTGA TTGAAATTGA ATATGATTCT
CTGTACTAAA AAACACTAAA AATTTTCAGT ATGGTATTTA TGGATTTCCA TGTTTACCTG GATGCATGAT TGAACATCTA
CTCTCTTTTG ATGCTTGTGG TTCAGATGTC TATGCTGCAA ACTGATATAT GATTTATATT AGCTTGTATT GTTCTCTGTA
CTGTCTAGAC AACAGAGCAC AACTACTGTC TAACAGAGAG CAGAGCACAA CACATAACCT TGATGACAGG CTATAATTTT
TGTTATTTTA TTCTTTTTGT ACAAATGATT CTCACCTGAA AGTTTTAACA CATTCCTACT TTAGGTGATG CGCGGTTGTG
CTGTTTGACA AGTCTTGCGC TGAATGTAAA GGTACATCAT CTCTACTCAG TCTTGCACTG AATCCCGTTG CAATTTTGCA
TCGTTAGCAT GTCTGCATGA TCTAAAAACG CAGGTTTAAC TTCACTTTTT TTTTTTCAAT AATATCAGCC TGAAACCCCT
GCTGGCTTCC TGATAACACA TGTACACAAA ACATGGCTCA AAGGATACTC TTCAGCGGAT GAGCAGTCCT CCAAGCTTTA
AACCCTTTTT CACCCCTGTG CACACGGAAT GAATTTACTT GATGATAAAT GAAGGACCTG CTCGTCTGAG AATCTCATTT
TCTTATTTAA TGTAATATAA ATGATCTGTC TCGTGACTCG TGCGATGATA AAGTGAACGA TCTCAGAAGG CAACTTCAAC
AAATGTTGGA TATGATTTTA CAGAGAGTTC AGAATTAGAT TTCATGACAC AAGTACCGCT 

Locus: Os01g0376700

Loading...

Locus: Os01g0376700

Loading...