Os01t0386500-01

Locus

Os01g0386500

Description

Conserved hypothetical protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsRNAG

Oryzabase Gene Name Synonym(s)

Receptor mediating netrin-dependent axon guidance homolog

Transcript Evidence

AK106513 (DDBJ, Best hit)

Protein Evidence

NP_001173243.1 (RefSeq)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Full-length cDNA

002-107-A08 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0386500-01)

Others

Oryzabase (12485)

Transcript

1776 bp

>Os01t0386500-01 Conserved hypothetical protein.
acatcaacatagcctcgagctcttcctctctctcctgccatggccggcgttgtctaccac
cagccgatctcctcctccgttgcttcccttcctattcccttttaccataggctttgcctc
actccggtgattccatttttcctatttcccctctcctttagccacttccacaagccacca
acggcaccaccaaagccggccggagctgagctcttgttgccgctgttccagccatcctct
tttccccctatgctttccaccgacctccccggatgcgcagcgagcgggaacacgcttggc
cgccgccgtcgaggccgttcaaccaccgaagcaccggcgccctgtcccttttcctctctg
ttgttgctcgggagaagaaacagaaggaaggagaggaacgggaggaagaagagacatatg
acaagtaggccccgctgcacagtaaccttcctcttttatttgattttaattcaatttcaa
tctttagacacccatatctttccaaccacaaatccaatcccaatgagactttgacctaaa
ttcatataatttcaaactcttcgttttgataccaaatttcctatttttaaaattttattt
aaaattctttatttaaaaacccttttccttatttatttatttactttctaattttaaatt
attttaattaacctttaAAAATTATTTTAAATTTATTTGATTTACTTTACATCCCCTtta
attttgaatttcttgttttatttaaaaacctttttaaattttaattatcctttaattttt
aaatgcaccttttttttaccattttaaattttatttctttaatctatttaaaaccccttt
tgtgtttaaatttctttgatttatttaaatactcattttatttctaaaccattcccaaac
catcccttagccactaaaaatccgctgttggaattttacgccttctctgaagacgttcgc
gtggtctcaaaccccgacgtcaaaccgttggctgtaaaacccggcataacctaatcccaa
tgtcgaagtgtcgctcttcgcaccccacgcctcaatgcttacagtggtcagagcctcact
actccctcgacatccacagcacaccagctttcgagctctgtgtgaccctagccgctctac
tatcactcacaactgtagagtaacactattccgtaaacctgtacaaaattttcccaactc
actagtcgtgatggttgaccatagcatcaactagatgagccaaatatttagccgttatgc
tgtccaaccttagcatcggctaACCAGTTCAAATATCTAGCAATCGTGCTGCTCAACTCT
AGCACTGACTAGAAACCAAATCCACCAAACAAACCCCACCTATCCAAATTATCTATTTCC
CCGATTTCTTTTGTTTTCAAATTAAAATTTATTTTGAACCATTCTTTTTCCTCTCGCCTT
GCTCCAATTTTATTTATTCCTTGGTTTTATCGTTTCTTTGTAGCAATTTGCTTATAGGCT
TTATTTGCCATCTTTTTCATATTCGTATGTTAGACCGTACAGCAAGTTCTATCGGCATCC
AAGGAGCTGACGTGGACCCAAATGGCTACGCTGAAACCATGGGAAATCTTAAGGCGCAAG
GCAAGACATAACTAAAATTTTGATCATATATAAAACTTGATATAATCTTCATATTTAAAT
TTGATGCATAATATCTTACTCTTTTAACATCTGATGGGTAGATGTTAAATGCTTTTAAGC
ATGATTACATGATATTAATAAGATACATTTGAGATC

CDS

291 bp

>Os01t0386500-01 Conserved hypothetical protein.
ttccatttttcctatttcccctctcctttagccacttccacaagccaccaacggcaccac
caaagccggccggagctgagctcttgttgccgctgttccagccatcctcttttcccccta
tgctttccaccgacctccccggatgcgcagcgagcgggaacacgcttggccgccgccgtc
gaggccgttcaaccaccgaagcaccggcgccctgtcccttttcctctctgttgttgctcg
ggagaagaaacagaaggaaggagaggaacgggaggaagaagagacatatga

Protein

97 aa

>Os01t0386500-01 Conserved hypothetical protein.
FHFSYFPSPLATSTSHQRHHQSRPELSSCCRCSSHPLFPLCFPPTSPDAQRAGTRLAAAV
EAVQPPKHRRPVPFPLCCCSGEETEGRRGTGGRRDI*

5'UTR

chr01:16226601..16226730 (- strand) : 130 bp

CDS

chr01:16226310..16226600 (- strand) : 291 bp

3'UTR

chr01:16224955..16226309 (- strand) : 1355 bp

FASTA

>Os01t0386500-01 class=Sequence position=chr01:16224955..16226730 (- strand)
acatcaacat agcctcgagc tcttcctctc tctcctgcca tggccggcgt tgtctaccac cagccgatct cctcctccgt
tgcttccctt cctattccct tttaccatag gctttgcctc actccggtga ttccattttt cctatttccc ctctccttta
gccacttcca caagccacca acggcaccac caaagccggc cggagctgag ctcttgttgc cgctgttcca gccatcctct
tttcccccta tgctttccac cgacctcccc ggatgcgcag cgagcgggaa cacgcttggc cgccgccgtc gaggccgttc
aaccaccgaa gcaccggcgc cctgtccctt ttcctctctg ttgttgctcg ggagaagaaa cagaaggaag gagaggaacg
ggaggaagaa gagacatatg acaagtaggc cccgctgcac agtaaccttc ctcttttatt tgattttaat tcaatttcaa
tctttagaca cccatatctt tccaaccaca aatccaatcc caatgagact ttgacctaaa ttcatataat ttcaaactct
tcgttttgat accaaatttc ctatttttaa aattttattt aaaattcttt atttaaaaac ccttttcctt atttatttat
ttactttcta attttaaatt attttaatta acctttaAAA ATTATTTTAA ATTTATTTGA TTTACTTTAC ATCCCCTtta
attttgaatt tcttgtttta tttaaaaacc tttttaaatt ttaattatcc tttaattttt aaatgcacct tttttttacc
attttaaatt ttatttcttt aatctattta aaaccccttt tgtgtttaaa tttctttgat ttatttaaat actcatttta
tttctaaacc attcccaaac catcccttag ccactaaaaa tccgctgttg gaattttacg ccttctctga agacgttcgc
gtggtctcaa accccgacgt caaaccgttg gctgtaaaac ccggcataac ctaatcccaa tgtcgaagtg tcgctcttcg
caccccacgc ctcaatgctt acagtggtca gagcctcact actccctcga catccacagc acaccagctt tcgagctctg
tgtgacccta gccgctctac tatcactcac aactgtagag taacactatt ccgtaaacct gtacaaaatt ttcccaactc
actagtcgtg atggttgacc atagcatcaa ctagatgagc caaatattta gccgttatgc tgtccaacct tagcatcggc
taACCAGTTC AAATATCTAG CAATCGTGCT GCTCAACTCT AGCACTGACT AGAAACCAAA TCCACCAAAC AAACCCCACC
TATCCAAATT ATCTATTTCC CCGATTTCTT TTGTTTTCAA ATTAAAATTT ATTTTGAACC ATTCTTTTTC CTCTCGCCTT
GCTCCAATTT TATTTATTCC TTGGTTTTAT CGTTTCTTTG TAGCAATTTG CTTATAGGCT TTATTTGCCA TCTTTTTCAT
ATTCGTATGT TAGACCGTAC AGCAAGTTCT ATCGGCATCC AAGGAGCTGA CGTGGACCCA AATGGCTACG CTGAAACCAT
GGGAAATCTT AAGGCGCAAG GCAAGACATA ACTAAAATTT TGATCATATA TAAAACTTGA TATAATCTTC ATATTTAAAT
TTGATGCATA ATATCTTACT CTTTTAACAT CTGATGGGTA GATGTTAAAT GCTTTTAAGC ATGATTACAT GATATTAATA
AGATACATTT GAGATC