Os01t0510100-01

Locus

Os01g0510100

Description

Mitogen activated protein kinase kinase, MAPK kinase 6, Low-temperature response, Regulation of cold stress tolerance, Abiotic stress signaling, UV induced regulation of genes in phytoalexins biosynthesis

RAP-DB Gene Symbol Synonym(s)

OsMKK6, OsMEK1

RAP-DB Gene Name Synonym(s)

mitogen activated protein kinase kinase 6

CGSNL Gene Symbol

MKK6

CGSNL Gene Name

MITOGEN-ACTIVATED PROTEIN KINASE KINASE 6

Oryzabase Gene Symbol Synonym(s)

OsMKK6, OsMEK1, MEK1

Oryzabase Gene Name Synonym(s)

MAPK kinase 6

Transcript Evidence

AK059461

Protein Evidence

Q5QN75

Literature

PMID: 24295067

PMID: 22248149

PMID: 18619847

PMID: 12177502

Note

Manual Curation

July 21, 2020

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: ATP binding (GO:0005524)

Functional domain (InterPro)

Protein kinase-like domain superfamily (IPR011009)

Protein kinase domain (IPR000719)

Protein kinase, ATP binding site (IPR017441)

Serine/threonine-protein kinase, active site (IPR008271)

Full-length cDNA

001-028-C11 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0510100-01)

RiceXPro (AK059461)

Others

Oryzabase (8832)

KEGG (Os01t0510100-01)

Transcript

1580 bp

>Os01t0510100-01 Mitogen activated protein kinase kinase, MAPK kinase 6, Low-temperature response, Regulation of cold stress tolerance, Abiotic stress signaling, UV induced regulation of genes in phytoalexins biosynthesis
ACGCTCTCCTTCCTTCCTTCCTTCTTCGCTTCTTCCGACGCCACTTCACCTCTCCTTCCT
CCCTCCCTCGCCGCCGCGGGCTGCTTCCTCCCTCCCTCCCGCCGCGTCCCGCCACTCCCG
GCTGATTACTCGAGCCGCCGCGGGGCAGATCCGTGCCGGGATAGGCCTCTCGCTCGCGCT
TCGGTCCCCCGTCTCTTACCGGCGGATAAACCCTAACCGGAGAGGAGGAGGAGGGGGAGG
CCATGAGGGGGAAGAAGCCGCACAAGGAGCTCAAGCTCTCCGTGCCTGCGCAGGAGACGC
CCGTCGACAAGTTCCTGACCGCGAGTGGTACATTCAAGGATGGTGAACTGCGGCTTAATC
AAAGAGGTTTGCAGCTTATATCCGAGGAAACTGCAGATGAACCTCAGTCAACAAACCTGA
AGGTGGAAGATGTTCAGTTGTCAATGGATGACCTTGAGATGATTCAAGTCATTGGTAAGG
GGAGTGGTGGTATCGTCCAACTAGTTCGGCACAAGTGGGTGGGGACATTATATGCCTTGA
AGGGCATACAAATGAACATTCAAGAGGCAGTTCGCAAACAAATAGTACAAGAGCTCAAAA
TAAATCAAGCAACACAGAACGCACATATAGTCCTTTGCCACCAATCTTTCTACCATAATG
GTGTAATATATCTTGTTCTAGAATACATGGACCGTGGATCTCTTGCAGATATCATTAAAC
AAGTCAAAACAATTCTGGAGCCATACCTGGCAGTACTTTGCAAACAGGTTTTGGAGGGTC
TACTGTATCTTCATCATGAAAGGCATGTGATTCACAGGGATATAAAGCCATCTAACTTGT
TAGTTAACCGTAAAGGTGAAGTAAAGATTACCGATTTTGGGGTAAGTGCGGTGCTAGCAA
GTTCAATGGGTCAGCGGGATACGTTTGTTGGAACCTACAACTATATGGCGCCTGAGCGTA
TTAGTGGAAGCTCCTATGACTACAAGAGTGACATATGGAGTTTGGGCTTAGTAATACTCG
AGTGTGCCATTGGTCGGTTCCCCTATATACCTTCAGAAGGGGAAGGTTGGTTAAGCTTCT
ACGAATTATTAGAAGCAATTGTTGACCAGCCACCACCCTCTGCACCAGCGGACCAGTTCT
CTCCAGAATTTTGTGCATTTATCTCCTCCTGCATACAAAAGGATCCTGCGGAGCGGATGT
CTGCTTCAGAACTCTTGAATCATCCTTTCATCAAGAAGTTTGAGGATAAGGATTTAGACC
TGCGCATTCTTGTCGAGAGCCTTGAACCTCCAATGAATATATCCGAGTAACTTGTCATTG
GGAGGAATGAGGTTTTGTCGGTCTCTTGGTAGCGGCACATGTTCCCTGCATGCGATGTAG
TGTGTATGATGTTGAAAATTCGGGAGGAGTTGCAGTAATGTATCGGTATAATTTTTCTTT
ACCTAAGGCCCTTTTGTTGCCTCTTTTTATGGTCCTGTGACTTGCGAGCATGACAATAGA
GGGAATCATGATTTCACCTTCGTATTGCATGGTGTCTTATCGTAGTTCTTGCTGCGAGTA
ATTGGTCCCCAATGTCCTTT

CDS

1068 bp

>Os01t0510100-01 Mitogen activated protein kinase kinase, MAPK kinase 6, Low-temperature response, Regulation of cold stress tolerance, Abiotic stress signaling, UV induced regulation of genes in phytoalexins biosynthesis
ATGAGGGGGAAGAAGCCGCACAAGGAGCTCAAGCTCTCCGTGCCTGCGCAGGAGACGCCC
GTCGACAAGTTCCTGACCGCGAGTGGTACATTCAAGGATGGTGAACTGCGGCTTAATCAA
AGAGGTTTGCAGCTTATATCCGAGGAAACTGCAGATGAACCTCAGTCAACAAACCTGAAG
GTGGAAGATGTTCAGTTGTCAATGGATGACCTTGAGATGATTCAAGTCATTGGTAAGGGG
AGTGGTGGTATCGTCCAACTAGTTCGGCACAAGTGGGTGGGGACATTATATGCCTTGAAG
GGCATACAAATGAACATTCAAGAGGCAGTTCGCAAACAAATAGTACAAGAGCTCAAAATA
AATCAAGCAACACAGAACGCACATATAGTCCTTTGCCACCAATCTTTCTACCATAATGGT
GTAATATATCTTGTTCTAGAATACATGGACCGTGGATCTCTTGCAGATATCATTAAACAA
GTCAAAACAATTCTGGAGCCATACCTGGCAGTACTTTGCAAACAGGTTTTGGAGGGTCTA
CTGTATCTTCATCATGAAAGGCATGTGATTCACAGGGATATAAAGCCATCTAACTTGTTA
GTTAACCGTAAAGGTGAAGTAAAGATTACCGATTTTGGGGTAAGTGCGGTGCTAGCAAGT
TCAATGGGTCAGCGGGATACGTTTGTTGGAACCTACAACTATATGGCGCCTGAGCGTATT
AGTGGAAGCTCCTATGACTACAAGAGTGACATATGGAGTTTGGGCTTAGTAATACTCGAG
TGTGCCATTGGTCGGTTCCCCTATATACCTTCAGAAGGGGAAGGTTGGTTAAGCTTCTAC
GAATTATTAGAAGCAATTGTTGACCAGCCACCACCCTCTGCACCAGCGGACCAGTTCTCT
CCAGAATTTTGTGCATTTATCTCCTCCTGCATACAAAAGGATCCTGCGGAGCGGATGTCT
GCTTCAGAACTCTTGAATCATCCTTTCATCAAGAAGTTTGAGGATAAGGATTTAGACCTG
CGCATTCTTGTCGAGAGCCTTGAACCTCCAATGAATATATCCGAGTAA

Protein

356 aa

>Os01t0510100-01 Mitogen activated protein kinase kinase, MAPK kinase 6, Low-temperature response, Regulation of cold stress tolerance, Abiotic stress signaling, UV induced regulation of genes in phytoalexins biosynthesis
MRGKKPHKELKLSVPAQETPVDKFLTASGTFKDGELRLNQRGLQLISEETADEPQSTNLK
VEDVQLSMDDLEMIQVIGKGSGGIVQLVRHKWVGTLYALKGIQMNIQEAVRKQIVQELKI
NQATQNAHIVLCHQSFYHNGVIYLVLEYMDRGSLADIIKQVKTILEPYLAVLCKQVLEGL
LYLHHERHVIHRDIKPSNLLVNRKGEVKITDFGVSAVLASSMGQRDTFVGTYNYMAPERI
SGSSYDYKSDIWSLGLVILECAIGRFPYIPSEGEGWLSFYELLEAIVDQPPPSAPADQFS
PEFCAFISSCIQKDPAERMSASELLNHPFIKKFEDKDLDLRILVESLEPPMNISE*

5'UTR

chr01:17904834..17905075 (+ strand) : 242 bp

CDS

chr01:17905076..17905149 (+ strand) : 74 bp

chr01:17905649..17905736 (+ strand) : 88 bp

chr01:17906086..17906223 (+ strand) : 138 bp

chr01:17906711..17906935 (+ strand) : 225 bp

chr01:17907067..17907249 (+ strand) : 183 bp

chr01:17907368..17907588 (+ strand) : 221 bp

chr01:17909531..17909576 (+ strand) : 46 bp

chr01:17909675..17909767 (+ strand) : 93 bp

3'UTR

chr01:17909768..17910037 (+ strand) : 270 bp

FASTA

>Os01t0510100-01 class=Sequence position=chr01:17904834..17910037 (+ strand)
ACGCTCTCCT TCCTTCCTTC CTTCTTCGCT TCTTCCGACG CCACTTCACC TCTCCTTCCT CCCTCCCTCG CCGCCGCGGG
CTGCTTCCTC CCTCCCTCCC GCCGCGTCCC GCCACTCCCG GCTGATTACT CGAGCCGCCG CGGGGCAGAT CCGTGCCGGG
ATAGGCCTCT CGCTCGCGCT TCGGTCCCCC GTCTCTTACC GGCGGATAAA CCCTAACCGG AGAGGAGGAG GAGGGGGAGG
CCATGAGGGG GAAGAAGCCG CACAAGGAGC TCAAGCTCTC CGTGCCTGCG CAGGAGACGC CCGTCGACAA GTTCCTGTAG
GGTCCCCCTC CCTCGGTTCC CTGGGCCTGA AACGTGCTCT TTTTTTTCTT TTTTTTTTTA CTGTCACTTG ATTTCGTTTT
CCTTTGTGTG TTCTCCTTTG GAGCGATCGG GTGTCATGAA CTTTCGAGGT TTTGCCTCTG GTATAGAAGG GCTTCTGTGT
TTTTTTTTAG TTATTTGTTG ACGATTTTGG AGTTCAGATC GAATTGTCTT GCATAGTGTC TTACTGTGAT TTTGGGGTTA
GTTATGAACT GAGATGGAGA TAAGATTTAC AGAAGCGTAG GTCTACTTAT ACTGTCTAAC TGATCTTTTG CTTGAAATAT
CTATGATCTG AGTTGCTGAA CTGACTCTTC AATCCTCACT TAGAGTGGCT GAAATGCTAT TCGTGGTTCC AGATCGTTTG
TTATTTTGTT TATCCATCAG CCTAATCGTT GATTTATGTT TCGGGAGTTC GTGGTAAAAT TTAATAGCTG TCACTGATCG
CTGGTGCTCC TTTAGGACCG CGAGTGGTAC ATTCAAGGAT GGTGAACTGC GGCTTAATCA AAGAGGTTTG CAGCTTATAT
CCGAGGAAAC TGCAGATGAA CCTGTGAGTT CCTGGTGCCA TGGCTACTTT TTTTGTTTGT TCATATCTCC CTACTGGGTT
CATGTAAACT GCTTTATCGT ACTCCTTATG GTGACATGTA GGTTAGTGTA GAAGCACATG TACAGGTTGA CTAGTTCAGT
CAAACCTTAT CATGCTTCTG TTGATTTTCA TTTGGCTGAT TGAATGCAAT ACTCACTTGC AATGCATGGG ATCCATGCCA
CTCATGCATT CTCGCAATGT ATTATGTGCT GCAATAGTGC TAAGGAATCA TTGTGTAAAC ATTTCAGAGT TTATCCATGG
ATATAACATT GTTCACATTT CTCAATTTCT GTTTCATCTT TATGTCTTCC AGCAGTCAAC AAACCTGAAG GTGGAAGATG
TTCAGTTGTC AATGGATGAC CTTGAGATGA TTCAAGTCAT TGGTAAGGGG AGTGGTGGTA TCGTCCAACT AGTTCGGCAC
AAGTGGGTGG GGACATTATA TGCCTTGAAG GTAATTTCCA TTACACAAAA TCCATCTAGT GTTCCACACT AATTCTTAAA
TGGAAAATGT ATATCTTGTG GCTGCATCAG GCTGCGAGTC CTTCAGTTGA ACTGTTTCTC TATCTTTATG TTTGTAATCA
TGGAAAGCTG GAAGTCAATC TCTCAGTTCC ATTTTGAACA TGTTTATCAT AATCAGATTA TTCTGCATCA TAGCATTTGA
TTGATTTTTT AATCAATTTG GTAGTGTTGG CACCTATTAG TATGTTCCCT GTTGAAATTA GGTGGGGCAT TCTACATAAA
TGGTGTAGCA GAAGCATCTG TCGTCAGCTT ACGTGTTGCA TGCAATATCT ACATTGAACT CTGATTTTCA ATTAATATTG
ATGCTAATGA AGAACATCAT GTTATGATGT TCAGATCAAT CAAGAATTCT GTGCATTGTC CCTGGTATTC ATACTGCTGT
GGCATTTAAT TAACTAGCAT TGCAATTCTG TCCACAGGGC ATACAAATGA ACATTCAAGA GGCAGTTCGC AAACAAATAG
TACAAGAGCT CAAAATAAAT CAAGCAACAC AGAACGCACA TATAGTCCTT TGCCACCAAT CTTTCTACCA TAATGGTGTA
ATATATCTTG TTCTAGAATA CATGGACCGT GGATCTCTTG CAGATATCAT TAAACAAGTC AAAACAATTC TGGAGCCATA
CCTGGCAGTA CTTTGCAAAC AGGTTAGCAT AAACTTAGCC TTTTATTTCT AACTTTCCCT GTTTTCGGAA TAAGCTTGGA
ATTTTGTCGC ATCTATCCAG TTGAAAAAGT ATTCTAACGT AAAAAAACAT TGCATGATAT TTTGACAACT CAGGTTTTGG
AGGGTCTACT GTATCTTCAT CATGAAAGGC ATGTGATTCA CAGGGATATA AAGCCATCTA ACTTGTTAGT TAACCGTAAA
GGTGAAGTAA AGATTACCGA TTTTGGGGTA AGTGCGGTGC TAGCAAGTTC AATGGGTCAG CGGGATACGT TTGTTGGAAC
CTACAACTAT ATGGCGGTAT GTTGAAATAA TGACCTGCTT TATTTATGTA CCCCTTAGTC TATGTTCAAG ACAGTGATCT
GATCTGGAAT TCATAAATTT GTTCTCATAG TTTCTACCTT TCTTCCTAGT TCAGCCTGAG CGTATTAGTG GAAGCTCCTA
TGACTACAAG AGTGACATAT GGAGTTTGGG CTTAGTAATA CTCGAGTGTG CCATTGGTCG GTTCCCCTAT ATACCTTCAG
AAGGGGAAGG TTGGTTAAGC TTCTACGAAT TATTAGAAGC AATTGTTGAC CAGCCACCAC CCTCTGCACC AGCGGACCAG
TTCTCTCCAG AATTTTGTGC ATTTATCTCC TCCTGGTATG ATAATCATCT CTCTGAAATT ACACATGAAA TTAGCTTTTA
TTACTGCTTT CCTGAGTATT CCCCTGCATA CTACTTTGGC TGTTTTGCTC TATATTTCAA AGTCTTGTTA GTCTTTTGTG
TGTGAGTCCA AAAAAAAAAA AAACTGGAAC TGCAAAAGAA ATGTTTGGAA TTATTGAGAA CGCTATTTGT AACTTGTATA
TATGTGTAGC AATTCCCTCT TCCAGGAAGT TGATGTATTT TCTGTACCAA AGTGTTCCTT TTGTTAACCT TTGAATATGC
TTAGCTTTAT TGTTAGCATT TGTGATCATG AAGAAGTTGA TGGACACAAT TAGTGAAATC CACAATCCTT TTTTTTAAAA
ATTTTCTACA ACCTTTTATA TTGCAGTCGA TCCTGCAATG TTATCCACTG GAAAGTTGTA ACTTCCTGCA ATTTTGTCAG
ATCACTTTGC ATACCAAGAG GCTTAAAGTG TAACTTTGCA GCCAATGGCT CAGTGGGCAA AACATGTAGC AGTGGGTTTG
AGCAAGCAAC CTTTGGTTTA CTTTTGTAGA CCATAGTTCT TAGCATTTTA ACGTGATACC TACATGGCCA TATTAAAAAT
TGTATTAGTC CTAAACGAGA TGCATGTAGT CTATTAAGGT CTTAACTTCA TCATTGCTTG AGCACTGAGG TGTCCAGGGG
CTACTGTCAC AGCTGCTGCC TCACCTAATT GATCATGTAC CACTCTTTAG ATGGTGAGTC TAGTATTTGC CACACTCTGG
AACCTAATTG ATTTCTTGCC ACCCTTTAGA TGGTGTTGGT TTACCAATTG CCTCTTTGAA CTTAATTGCA TCTCCTTTCC
TATTTTGCTC TTGTTCAATG CTATGCTTCA AAAGAACAAG TGGAATAACT GATTTGATGA AGATAAGGGA GAAAGCTGGA
GGTCAGAAGT CAGCAAATCT TTCAGTGTCC ATGGTCACCC TCAAACGTTA GTGGTACTTA TTGACAAAAA GCTGATCTGG
AGCTCCAACT TGTAGAACTT GGCAAGCTTT CTGTATCTAG AACAGAAGCA TGAGCAAGAA TTTTGCACCA AGCAATTAAA
GGTTATAATG GATCTGAATG ACTAAAACCC AAGAAAGAAT CTTGCACCAA GTAATATTGC TCGTTCTTAC CACAAAGGAA
TCAAATCCAG ACAAAAGTAG TCATCAATGT GATGAAATCA CAGGAGATAA GCCAGGTGAG CTTGATGCAC TTGGTTAGGT
CAGAGGAGCT CTCCAATGAG TCGATGGAAG AGGCCATGGT GCTGGGGAGC TGGAGCCCTA GCTGCAGCAA ATCCAGACAA
AAGTAGATGG TGGGGGTATG CGGCGCTATG GGTGTGGAAG GCAGTTTAGG CTATTGCTGG CATCTCTGAA TTGAAGAGGG
GTGGAAACTT GAGGTCAGAT GATGGAGTAA GAAGGGCAAA ATGAGAACTT GTGGTGGGGA TTGTGTAAAA AAAAAAGGTA
GATGCAATTA GGTACAAAAT AGCAATATTC TAGATCAAGC ACATCTAATT GGTGGCATTT TATCAATTAG TTTCTAGGGT
GATTGCAAAT CAAGTTATTT AAAGGGCAGC AAAATATCTA GGTGTTTTCC AGATTAATAA AACCTTTGCT GTGAGATAGT
TACGGACTAA ACAGTAGTAT ACCCACCCTG GCCCAGTGTC CCACATCATG ACTAGTATCA ATTTGCGTTG CTGTCAGATT
GTTGTTTACA GAAGTACTTT TGAACTTCTT TGCTTAAGTC AAATTATGCA TGCAAATAAC AGTGTCTTGT GTGCTCCTAT
ATCTGATTTC ATGACTAATC TATAAGGATA CAAGCATGGC TTGAGGGTAA ATAACAGTTT CTTCCAACTT ATCATTAAAG
ATTCATTTCA TCAGCTTATC ATAGTCTAAT CTTATTTATT GTTACATTGC TTTGCAGCAT ACAAAAGGAT CCTGCGGAGC
GGATGTCTGC TTCAGAACTC TTGGTCAGCA TTGCCTTCTA TTTAATAATT TTTGTAGCGA ACTTAACTGT AATAACATCT
TTCGACCATC TTGTTCTGAA CTGTCATATA TATTCTTGCA GAATCATCCT TTCATCAAGA AGTTTGAGGA TAAGGATTTA
GACCTGCGCA TTCTTGTCGA GAGCCTTGAA CCTCCAATGA ATATATCCGA GTAACTTGTC ATTGGGAGGA ATGAGGTTTT
GTCGGTCTCT TGGTAGCGGC ACATGTTCCC TGCATGCGAT GTAGTGTGTA TGATGTTGAA AATTCGGGAG GAGTTGCAGT
AATGTATCGG TATAATTTTT CTTTACCTAA GGCCCTTTTG TTGCCTCTTT TTATGGTCCT GTGACTTGCG AGCATGACAA
TAGAGGGAAT CATGATTTCA CCTTCGTATT GCATGGTGTC TTATCGTAGT TCTTGCTGCG AGTAATTGGT CCCCAATGTC
CTTT

Locus: Os01g0510100

Loading...

Locus: Os01g0510100

Loading...