Os01t0532600-00

Locus

Os01g0532600

Description

Similar to HKT1 (High-affinity potassium uptake transporter).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

HKT3

CGSNL Gene Name

HIGH-AFFINITY K+ TRANSPORTER 3

Oryzabase Gene Symbol Synonym(s)

OsHKT3, OsHKT2;3, HKT2;3

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AJ491820 (DDBJ, Best hit)

Protein Evidence

Q3V5P8 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: cation transport (GO:0006812)

Biological Process: transmembrane transport (GO:0055085)

Molecular Function: cation transmembrane transporter activity (GO:0008324)

Functional domain (InterPro)

Cation transporter (IPR003445)

Expression Databases

TENOR (Os01t0532600-00)

RiceXPro (AJ491820)

Others

Oryzabase (9019)

KEGG (Os01t0532600-00)

Transcript

1587 bp

>Os01t0532600-00 Similar to HKT1 (High-affinity potassium uptake transporter).
CTCTGCCCTCTATCTCCAATGCCTATTCGGCTGCATATCTTTGTCAATTCTGCAAGGCAT
GCCATCAACTCATCGGCATTCATTTGTCGGTTCATCGCATACCATCTTAGCCCGCTTTTG
ATTCACTTATCCTATTTTCTTATCATTGATATACTTGGTTTTGTTTCCTTGGTGGTGCTC
AGGCCAAGCAACCACAAGTACAATCCTCGCTATGTTGATATGTTTTTCCTATCGACATCT
GCAGTTACAGTCATAGGATTAGCCACCATACAAATGGAGGATCTTTCCAGCTCTCAGATA
GCTATCCTGACTCTCTTGATGTTCTTAGACAGTAAGATGTTCCTTTCCTTTCTTGGCCTT
GTCCTTGAGTCAAGCAAGCAAAACAAGCATGATCCTGAAAACCGTAGAGTCAGTTCAGTT
ACTGTGTGCAAGCAATCACAGCTAGAAGAGGCGACTCCCCAAACTCCATCCATGAACTCC
ATTGATATCAAGAAGAGATGCCTCAAATACTTAGTGTTTGTGGTGCTGGCATACATGATC
ATTATTCTTGTCACTGGTTCTCTATTGGTGTTCATGTACATAGCTCATGTTTCAAGTGCT
AGAGATGTGCTAACAAGGAAAAGCATCAACAAAGCTCTCTTCTCGATATCGGTCACAGTC
TCCTCATTCACAAATGGAGGGTTATTGCCGACAAATGAGAGTATGGTTGTATTCTCCTCA
AACAATGGCCTCCTGTTGCTACTCATTGGCCAGATTCTTGCAGGCAGCACACTGTTCCCT
GTGTTTCTGAGGTTGGTGATATGGGCATTGAGAGGACTAAGATTAGCAAAAGCTGAAGAG
CCTGACTTCATGATGAACAACAGCAGCGCAGTAGGTTTCAGTCACCTGCTGCCTAACTTG
CAGACAATATTTCTTGCAGTTGTGGAGGTTGCTTTTGTAGCCATGACAGTCATCCTCTTC
TGCTGCTTGAACTGGGATTCTGTAGTGTTTGCAGGGCTCAGCTCCCTCCAGAAGATAACC
AATGCATTGTTCATGGCAGTGAATGCAAGGCAGGCAGGAGAAAATTCCATTGATTGTTCC
CTTGTTGCGCCAGCGGCTTTAGTACTATTCATGGTCATGATGTACACTCCATCCTTGACA
AAGTTGTTCTCAGCATGTCAAGATCACAAACGAATCGGCCCAGAAAGCGACGATAGAACA
AGCAAGGGGAAACCATTCCTGAAGATGATGGCATTTTCACCACTCGGCTTCAACACCACA
GTGATAATGCTGGTCTGCATCACTGAAAGGAGATCACTCTCCACTGACCCTCTCAATTTA
TCCACATTTAACATCATCTTTGAGGTGATAAGTGCCTACGGGAACATTGGGTTGTCCACT
GGCTACAGCTGCTCGAGGCAGCTGCAGCACCAGGAGGGGATTGCCTGCCATGAGAAGGCG
TACAACTTCTCGGGGTGGTGGAGTGAACCAGGGAAACTGATTCTTGTTCTTGCAATGCTC
TGCGGGAGGCTCAACTCAAAGGATTCCACAAGCGCACGAACTAGGTGATGATGATCAGAA
GCGATCAGTATGCGATCGATGTTCTGC

CDS

1530 bp

>Os01t0532600-00 Similar to HKT1 (High-affinity potassium uptake transporter).
ATGCCTATTCGGCTGCATATCTTTGTCAATTCTGCAAGGCATGCCATCAACTCATCGGCA
TTCATTTGTCGGTTCATCGCATACCATCTTAGCCCGCTTTTGATTCACTTATCCTATTTT
CTTATCATTGATATACTTGGTTTTGTTTCCTTGGTGGTGCTCAGGCCAAGCAACCACAAG
TACAATCCTCGCTATGTTGATATGTTTTTCCTATCGACATCTGCAGTTACAGTCATAGGA
TTAGCCACCATACAAATGGAGGATCTTTCCAGCTCTCAGATAGCTATCCTGACTCTCTTG
ATGTTCTTAGACAGTAAGATGTTCCTTTCCTTTCTTGGCCTTGTCCTTGAGTCAAGCAAG
CAAAACAAGCATGATCCTGAAAACCGTAGAGTCAGTTCAGTTACTGTGTGCAAGCAATCA
CAGCTAGAAGAGGCGACTCCCCAAACTCCATCCATGAACTCCATTGATATCAAGAAGAGA
TGCCTCAAATACTTAGTGTTTGTGGTGCTGGCATACATGATCATTATTCTTGTCACTGGT
TCTCTATTGGTGTTCATGTACATAGCTCATGTTTCAAGTGCTAGAGATGTGCTAACAAGG
AAAAGCATCAACAAAGCTCTCTTCTCGATATCGGTCACAGTCTCCTCATTCACAAATGGA
GGGTTATTGCCGACAAATGAGAGTATGGTTGTATTCTCCTCAAACAATGGCCTCCTGTTG
CTACTCATTGGCCAGATTCTTGCAGGCAGCACACTGTTCCCTGTGTTTCTGAGGTTGGTG
ATATGGGCATTGAGAGGACTAAGATTAGCAAAAGCTGAAGAGCCTGACTTCATGATGAAC
AACAGCAGCGCAGTAGGTTTCAGTCACCTGCTGCCTAACTTGCAGACAATATTTCTTGCA
GTTGTGGAGGTTGCTTTTGTAGCCATGACAGTCATCCTCTTCTGCTGCTTGAACTGGGAT
TCTGTAGTGTTTGCAGGGCTCAGCTCCCTCCAGAAGATAACCAATGCATTGTTCATGGCA
GTGAATGCAAGGCAGGCAGGAGAAAATTCCATTGATTGTTCCCTTGTTGCGCCAGCGGCT
TTAGTACTATTCATGGTCATGATGTACACTCCATCCTTGACAAAGTTGTTCTCAGCATGT
CAAGATCACAAACGAATCGGCCCAGAAAGCGACGATAGAACAAGCAAGGGGAAACCATTC
CTGAAGATGATGGCATTTTCACCACTCGGCTTCAACACCACAGTGATAATGCTGGTCTGC
ATCACTGAAAGGAGATCACTCTCCACTGACCCTCTCAATTTATCCACATTTAACATCATC
TTTGAGGTGATAAGTGCCTACGGGAACATTGGGTTGTCCACTGGCTACAGCTGCTCGAGG
CAGCTGCAGCACCAGGAGGGGATTGCCTGCCATGAGAAGGCGTACAACTTCTCGGGGTGG
TGGAGTGAACCAGGGAAACTGATTCTTGTTCTTGCAATGCTCTGCGGGAGGCTCAACTCA
AAGGATTCCACAAGCGCACGAACTAGGTGA

Protein

510 aa

>Os01t0532600-00 Similar to HKT1 (High-affinity potassium uptake transporter).
MPIRLHIFVNSARHAINSSAFICRFIAYHLSPLLIHLSYFLIIDILGFVSLVVLRPSNHK
YNPRYVDMFFLSTSAVTVIGLATIQMEDLSSSQIAILTLLMFLDSKMFLSFLGLVLESSK
QNKHDPENRRVSSVTVCKQSQLEEATPQTPSMNSIDIKKRCLKYLVFVVLAYMIIILVTG
SLLVFMYIAHVSSARDVLTRKSINKALFSISVTVSSFTNGGLLPTNESMVVFSSNNGLLL
LLIGQILAGSTLFPVFLRLVIWALRGLRLAKAEEPDFMMNNSSAVGFSHLLPNLQTIFLA
VVEVAFVAMTVILFCCLNWDSVVFAGLSSLQKITNALFMAVNARQAGENSIDCSLVAPAA
LVLFMVMMYTPSLTKLFSACQDHKRIGPESDDRTSKGKPFLKMMAFSPLGFNTTVIMLVC
ITERRSLSTDPLNLSTFNIIFEVISAYGNIGLSTGYSCSRQLQHQEGIACHEKAYNFSGW
WSEPGKLILVLAMLCGRLNSKDSTSARTR*

5'UTR

chr01:19242042..19242059 (+ strand) : 18 bp

CDS

chr01:19242060..19243162 (+ strand) : 1103 bp

chr01:19243246..19243476 (+ strand) : 231 bp

chr01:19243578..19243773 (+ strand) : 196 bp

3'UTR

chr01:19243774..19243812 (+ strand) : 39 bp

FASTA

>Os01t0532600-00 class=Sequence position=chr01:19242042..19243812 (+ strand)
CTCTGCCCTC TATCTCCAAT GCCTATTCGG CTGCATATCT TTGTCAATTC TGCAAGGCAT GCCATCAACT CATCGGCATT
CATTTGTCGG TTCATCGCAT ACCATCTTAG CCCGCTTTTG ATTCACTTAT CCTATTTTCT TATCATTGAT ATACTTGGTT
TTGTTTCCTT GGTGGTGCTC AGGCCAAGCA ACCACAAGTA CAATCCTCGC TATGTTGATA TGTTTTTCCT ATCGACATCT
GCAGTTACAG TCATAGGATT AGCCACCATA CAAATGGAGG ATCTTTCCAG CTCTCAGATA GCTATCCTGA CTCTCTTGAT
GTTCTTAGAC AGTAAGATGT TCCTTTCCTT TCTTGGCCTT GTCCTTGAGT CAAGCAAGCA AAACAAGCAT GATCCTGAAA
ACCGTAGAGT CAGTTCAGTT ACTGTGTGCA AGCAATCACA GCTAGAAGAG GCGACTCCCC AAACTCCATC CATGAACTCC
ATTGATATCA AGAAGAGATG CCTCAAATAC TTAGTGTTTG TGGTGCTGGC ATACATGATC ATTATTCTTG TCACTGGTTC
TCTATTGGTG TTCATGTACA TAGCTCATGT TTCAAGTGCT AGAGATGTGC TAACAAGGAA AAGCATCAAC AAAGCTCTCT
TCTCGATATC GGTCACAGTC TCCTCATTCA CAAATGGAGG GTTATTGCCG ACAAATGAGA GTATGGTTGT ATTCTCCTCA
AACAATGGCC TCCTGTTGCT ACTCATTGGC CAGATTCTTG CAGGCAGCAC ACTGTTCCCT GTGTTTCTGA GGTTGGTGAT
ATGGGCATTG AGAGGACTAA GATTAGCAAA AGCTGAAGAG CCTGACTTCA TGATGAACAA CAGCAGCGCA GTAGGTTTCA
GTCACCTGCT GCCTAACTTG CAGACAATAT TTCTTGCAGT TGTGGAGGTT GCTTTTGTAG CCATGACAGT CATCCTCTTC
TGCTGCTTGA ACTGGGATTC TGTAGTGTTT GCAGGGCTCA GCTCCCTCCA GAAGATAACC AATGCATTGT TCATGGCAGT
GAATGCAAGG CAGGCAGGAG AAAATTCCAT TGATTGTTCC CTTGTTGCGC CAGCGGCTTT AGTACTATTC ATGGTCATGA
TGTGAGTTCC TCTCTTTCAA GTTCTTCACA GTCTCAGGCA ACAATCAGAA GAGATAACAT AACATGGTTG CTTACATTTC
TTAGGTACAC TCCATCCTTG ACAAAGTTGT TCTCAGCATG TCAAGATCAC AAACGAATCG GCCCAGAAAG CGACGATAGA
ACAAGCAAGG GGAAACCATT CCTGAAGATG ATGGCATTTT CACCACTCGG CTTCAACACC ACAGTGATAA TGCTGGTCTG
CATCACTGAA AGGAGATCAC TCTCCACTGA CCCTCTCAAT TTATCCACAT TTAACATCAT CTTTGAGGTG ATAAGGTAAC
AAATAACACT TGCACACACA CAATTCTTCT CATAATGTTC TTGCTCACCT CCATGACTAT TTTGAGTTAT TCATCACCCA
TTGCTTCTGC ACACAGTGCC TACGGGAACA TTGGGTTGTC CACTGGCTAC AGCTGCTCGA GGCAGCTGCA GCACCAGGAG
GGGATTGCCT GCCATGAGAA GGCGTACAAC TTCTCGGGGT GGTGGAGTGA ACCAGGGAAA CTGATTCTTG TTCTTGCAAT
GCTCTGCGGG AGGCTCAACT CAAAGGATTC CACAAGCGCA CGAACTAGGT GATGATGATC AGAAGCGATC AGTATGCGAT
CGATGTTCTG C

Locus: Os01g0532600

Loading...

Locus: Os01g0532600

Loading...