Os01t0544450-01

Locus

Os01g0544450

Description

Similar to DNA replication licensing factor mcm4.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

MCM4

CGSNL Gene Name

MINI-CHROMOSOME MAINTENANCE PROTEIN 4

Oryzabase Gene Symbol Synonym(s)

OsMCM4

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK288475 (DDBJ, Best hit)

Protein Evidence

NP_001147978.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: DNA replication (GO:0006260)

Biological Process: DNA-dependent DNA replication initiation (GO:0006270)

Molecular Function: nucleotide binding (GO:0000166)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: nucleoside-triphosphatase activity (GO:0017111)

Functional domain (InterPro)

Mini-chromosome maintenance, DNA-dependent ATPase (IPR001208)

ATPase, AAA+ type, core (IPR003593)

Mini-chromosome maintenance complex protein 4 (IPR008047)

Nucleic acid-binding, OB-fold (IPR012340)

Nucleic acid-binding, OB-fold-like (IPR016027)

Mini-chromosome maintenance, conserved site (IPR018525)

Full-length cDNA

J090038A13 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0544450-01)

Others

Oryzabase (9200)

KEGG (Os01t0544450-01)

Transcript

2811 bp

>Os01t0544450-01 Similar to DNA replication licensing factor mcm4.
TGCTCTCTCTGCTCGCGCGGAAGCCATGGCGTCTCGCGGCGGTGGCGGCGGCGGCGACGG
CAATTCCCCTCCTCCCTCCGTGTCGTCGCCGGATGTGCGACCGTCGAGCCCTCTCCCGGC
GACCAACTCCTCCCCGCCTCAGTCGGGGCGGCGCGGCGGGGGGCGGCGCCGGCGTGGTTC
CGCCAGCCCGTACCCGTCGTCCCCGTCCCTCGGCGGGTTCGAGACGCCGCCGCACCCGGG
CCGCCGCACGCCCTCCGGCGGCGCGGCGGCGCGGCAGCAGCGGCAGAACTGGACGGGGGG
GCGGTTCCCGCCGACCCCGTCCACCCCCATGTCCACCGACGACGTCCCGCTCTCCTCGGA
GGCCGGGGACGAGGACACCCCCGAGACCGACGGCGGCGGCGGCGGCGGCGCGGGCGCCGA
CGCCACGCCGGTGTTCGTCTGGGGCACCAACATCAGCGTGCAGGACGTCAACGCCGCCAT
CCTCCGGTTCCTCCGCCACTTCCGCGACCCGCGCGACGCCGGCCGCGTCGACCCGGTCAT
GGACGAGGGCAAGTACATGCGCGCCATCCACCGCATCCTCGAGCTCGAGGGCGGGGAGTC
GCTCGACGTCAACGCCCACGACGTGTTCGACCACGACCCGGACCTCTACGGCAAGATGGT
CAGGTACCCGCTCGAGGTGCTCGCCATCTTTGACATCGTGCTCATGGACCTCGTCGCGCG
CATCGAGCCCCTCTTCGAGAAGCACATCCAGACCAGGATCTACAACCTCAAGTCCTCGGT
TTGCTTGAGGAATCTCAACCCTTCTGATATCGAGAAGATGGTGTCCATCAAGGGTATGAT
AATTCGGTGCAGCTCGGTGATTCCAGAGCTCAAGGAGGCTGTGTTCCGCTGCTTGGTTTG
CGGGTTCTACTCTGAGCCTGTAATGGTTGATCGAGGGAGGGTTACTGAGCCGCACATCTG
TCAGAAAGAACAATGTAAAGCTACAAACTCTATGACTCTTGTGCATAACCGATGCAGGTT
TGCAGATAAGCAGATCATAAAGTTGCAGGAAACACCAGATGAGATACCAGAAGGTGGCAC
TCCACATACTGTTAGTGTCTTGATGCACGATAAGCTTGTAGATGCTGGAAAGCCTGGAGA
CAGGGTTGAGATAACTGGGATATACAGAGCCATGAGTATTAGAGTTGGCCCAACTCAGAG
GACAGTGAAGTCGATTTTCAAGACGTACATTGATTGCCTTCACATAAAGAAGACAGACAA
GTCTAGACTTCATGTTGAGGACTCCATGGAAACTGATAACCCCAATGCTAACAAGACAAC
TGAAGATGATTTTCTCAGAGATAAGGTTGAGAAATTAAAAGAGTTGTCAAAGTTGCCAGA
TATATATGACAGATTAACTAGGTCATTGGCTCCAAACATATGGGAGCTGGACGACGTTAA
AAGGGGCCTCCTTTGCCAGCTTTTTGGTGGAAATGCTTTGAGGCTTCCTTCTGGAGCTAG
TTTCCGAGGCGACATCAATATTTTGCTTGTTGGTGATCCTGGAACAAGTAAATCCCAGCT
TCTCCAATACATGCACAAACTGTCTCCTCGTGGCATTTATACAAGTGGCAGAGGAAGTTC
AGCTGTTGGCCTTACTGCATACGTTACCAAGGATCCTGAAACTGGTGAAACTGTTCTTGA
GAGTGGAGCGCTTGTTTTGAGTGACAAAGGTGTTTGTTGTATTGATGAATTTGATAAGAT
GTCTGATAATGCTCGAAGCATGTTACATGAGGTGATGGAACAACAGACTGTCTCCATTGC
CAAGGCTGGAATAATTGCATCTTTAAATGCCAGAACATCAGTTCTAGCATGTGCAAATCC
TACTGAATCACGTTATAATCCAAGGCTCTCTGTGATTGACAATATCCATCTTCCTCCAAC
ACTGCTTTCTAGGTTTGACCTCATTTATCTGATATTGGACAAGGCAGATGAGCAAACTGA
TAGACGCCTGGCTAAGCATATTGTTTCGTTGCATTTTGAGAATCCAAACATAGAGGAGCT
CGAGGTCTTGGATTTGCCAACACTTGTAGCCTACATAAGTTATGCAAGGAAGCATATACA
ACCACAGTTATCTGATGAAGCTGCAGAAGAATTGACTCGCGGCTATGTTGAGATGAGGAA
AAGAGGAAACAGCCCTGGTAGCAGAAAGAAGGTCATAACTGCGACAGCTCGACAAATTGA
GAGCTTGATTCGGCTCAGTGAAGCACTGGCCCGAATGCGATTCTCTGAAATGGTTGAAGT
ACAAGATGTTGTAGAGGCCTTCAGGCTTCTCGAAGTTGCCATGCAGCAATCGGCAACTGA
TCATGCCACTGGTACAATCGATATGGATCTTATCATGACTGGAATATCTGCGAGCGAAAG
GCAGAGGCGGGACAATCTCGTTGCAGCAACCCGCAACCTTGTGATGGAGAAAATGCAGCT
TGGAGGGCCCTCAGTGCGAATGATTGAGTTGCTGGAAGAAATTAGGAAGCAGAGCTCTAT
GGAAGTTCATCTGCATGATCTTCGCGGTGCTCTTGGCACTCTGATGACAGAGGGTGCCGT
AGTCATCCATGGAGACAGCGTCAAGAGGGTCTGATGCCTTATTATTTGCGATCTCTCTAG
CTAATGTTCTGATCCGTTGTTAGTGCTCTCAATTGGAGACTGCTTACACATCGGACTTAT
TGTCTAACTGTATAATTTTTAGATAATGTTTCTTGTTACGGTTGCTTACATGAAAACAAG
CAAGTGTTAATCAGAGTTGTAATGTAATGCATCAGTTTCCTTTTAGTCAAC

CDS

2589 bp

>Os01t0544450-01 Similar to DNA replication licensing factor mcm4.
ATGGCGTCTCGCGGCGGTGGCGGCGGCGGCGACGGCAATTCCCCTCCTCCCTCCGTGTCG
TCGCCGGATGTGCGACCGTCGAGCCCTCTCCCGGCGACCAACTCCTCCCCGCCTCAGTCG
GGGCGGCGCGGCGGGGGGCGGCGCCGGCGTGGTTCCGCCAGCCCGTACCCGTCGTCCCCG
TCCCTCGGCGGGTTCGAGACGCCGCCGCACCCGGGCCGCCGCACGCCCTCCGGCGGCGCG
GCGGCGCGGCAGCAGCGGCAGAACTGGACGGGGGGGCGGTTCCCGCCGACCCCGTCCACC
CCCATGTCCACCGACGACGTCCCGCTCTCCTCGGAGGCCGGGGACGAGGACACCCCCGAG
ACCGACGGCGGCGGCGGCGGCGGCGCGGGCGCCGACGCCACGCCGGTGTTCGTCTGGGGC
ACCAACATCAGCGTGCAGGACGTCAACGCCGCCATCCTCCGGTTCCTCCGCCACTTCCGC
GACCCGCGCGACGCCGGCCGCGTCGACCCGGTCATGGACGAGGGCAAGTACATGCGCGCC
ATCCACCGCATCCTCGAGCTCGAGGGCGGGGAGTCGCTCGACGTCAACGCCCACGACGTG
TTCGACCACGACCCGGACCTCTACGGCAAGATGGTCAGGTACCCGCTCGAGGTGCTCGCC
ATCTTTGACATCGTGCTCATGGACCTCGTCGCGCGCATCGAGCCCCTCTTCGAGAAGCAC
ATCCAGACCAGGATCTACAACCTCAAGTCCTCGGTTTGCTTGAGGAATCTCAACCCTTCT
GATATCGAGAAGATGGTGTCCATCAAGGGTATGATAATTCGGTGCAGCTCGGTGATTCCA
GAGCTCAAGGAGGCTGTGTTCCGCTGCTTGGTTTGCGGGTTCTACTCTGAGCCTGTAATG
GTTGATCGAGGGAGGGTTACTGAGCCGCACATCTGTCAGAAAGAACAATGTAAAGCTACA
AACTCTATGACTCTTGTGCATAACCGATGCAGGTTTGCAGATAAGCAGATCATAAAGTTG
CAGGAAACACCAGATGAGATACCAGAAGGTGGCACTCCACATACTGTTAGTGTCTTGATG
CACGATAAGCTTGTAGATGCTGGAAAGCCTGGAGACAGGGTTGAGATAACTGGGATATAC
AGAGCCATGAGTATTAGAGTTGGCCCAACTCAGAGGACAGTGAAGTCGATTTTCAAGACG
TACATTGATTGCCTTCACATAAAGAAGACAGACAAGTCTAGACTTCATGTTGAGGACTCC
ATGGAAACTGATAACCCCAATGCTAACAAGACAACTGAAGATGATTTTCTCAGAGATAAG
GTTGAGAAATTAAAAGAGTTGTCAAAGTTGCCAGATATATATGACAGATTAACTAGGTCA
TTGGCTCCAAACATATGGGAGCTGGACGACGTTAAAAGGGGCCTCCTTTGCCAGCTTTTT
GGTGGAAATGCTTTGAGGCTTCCTTCTGGAGCTAGTTTCCGAGGCGACATCAATATTTTG
CTTGTTGGTGATCCTGGAACAAGTAAATCCCAGCTTCTCCAATACATGCACAAACTGTCT
CCTCGTGGCATTTATACAAGTGGCAGAGGAAGTTCAGCTGTTGGCCTTACTGCATACGTT
ACCAAGGATCCTGAAACTGGTGAAACTGTTCTTGAGAGTGGAGCGCTTGTTTTGAGTGAC
AAAGGTGTTTGTTGTATTGATGAATTTGATAAGATGTCTGATAATGCTCGAAGCATGTTA
CATGAGGTGATGGAACAACAGACTGTCTCCATTGCCAAGGCTGGAATAATTGCATCTTTA
AATGCCAGAACATCAGTTCTAGCATGTGCAAATCCTACTGAATCACGTTATAATCCAAGG
CTCTCTGTGATTGACAATATCCATCTTCCTCCAACACTGCTTTCTAGGTTTGACCTCATT
TATCTGATATTGGACAAGGCAGATGAGCAAACTGATAGACGCCTGGCTAAGCATATTGTT
TCGTTGCATTTTGAGAATCCAAACATAGAGGAGCTCGAGGTCTTGGATTTGCCAACACTT
GTAGCCTACATAAGTTATGCAAGGAAGCATATACAACCACAGTTATCTGATGAAGCTGCA
GAAGAATTGACTCGCGGCTATGTTGAGATGAGGAAAAGAGGAAACAGCCCTGGTAGCAGA
AAGAAGGTCATAACTGCGACAGCTCGACAAATTGAGAGCTTGATTCGGCTCAGTGAAGCA
CTGGCCCGAATGCGATTCTCTGAAATGGTTGAAGTACAAGATGTTGTAGAGGCCTTCAGG
CTTCTCGAAGTTGCCATGCAGCAATCGGCAACTGATCATGCCACTGGTACAATCGATATG
GATCTTATCATGACTGGAATATCTGCGAGCGAAAGGCAGAGGCGGGACAATCTCGTTGCA
GCAACCCGCAACCTTGTGATGGAGAAAATGCAGCTTGGAGGGCCCTCAGTGCGAATGATT
GAGTTGCTGGAAGAAATTAGGAAGCAGAGCTCTATGGAAGTTCATCTGCATGATCTTCGC
GGTGCTCTTGGCACTCTGATGACAGAGGGTGCCGTAGTCATCCATGGAGACAGCGTCAAG
AGGGTCTGA

Protein

863 aa

>Os01t0544450-01 Similar to DNA replication licensing factor mcm4.
MASRGGGGGGDGNSPPPSVSSPDVRPSSPLPATNSSPPQSGRRGGGRRRRGSASPYPSSP
SLGGFETPPHPGRRTPSGGAAARQQRQNWTGGRFPPTPSTPMSTDDVPLSSEAGDEDTPE
TDGGGGGGAGADATPVFVWGTNISVQDVNAAILRFLRHFRDPRDAGRVDPVMDEGKYMRA
IHRILELEGGESLDVNAHDVFDHDPDLYGKMVRYPLEVLAIFDIVLMDLVARIEPLFEKH
IQTRIYNLKSSVCLRNLNPSDIEKMVSIKGMIIRCSSVIPELKEAVFRCLVCGFYSEPVM
VDRGRVTEPHICQKEQCKATNSMTLVHNRCRFADKQIIKLQETPDEIPEGGTPHTVSVLM
HDKLVDAGKPGDRVEITGIYRAMSIRVGPTQRTVKSIFKTYIDCLHIKKTDKSRLHVEDS
METDNPNANKTTEDDFLRDKVEKLKELSKLPDIYDRLTRSLAPNIWELDDVKRGLLCQLF
GGNALRLPSGASFRGDINILLVGDPGTSKSQLLQYMHKLSPRGIYTSGRGSSAVGLTAYV
TKDPETGETVLESGALVLSDKGVCCIDEFDKMSDNARSMLHEVMEQQTVSIAKAGIIASL
NARTSVLACANPTESRYNPRLSVIDNIHLPPTLLSRFDLIYLILDKADEQTDRRLAKHIV
SLHFENPNIEELEVLDLPTLVAYISYARKHIQPQLSDEAAEELTRGYVEMRKRGNSPGSR
KKVITATARQIESLIRLSEALARMRFSEMVEVQDVVEAFRLLEVAMQQSATDHATGTIDM
DLIMTGISASERQRRDNLVAATRNLVMEKMQLGGPSVRMIELLEEIRKQSSMEVHLHDLR
GALGTLMTEGAVVIHGDSVKRV*

5'UTR

chr01:20192025..20192049 (+ strand) : 25 bp

CDS

chr01:20192050..20192101 (+ strand) : 52 bp

chr01:20192181..20192909 (+ strand) : 729 bp

chr01:20192993..20193121 (+ strand) : 129 bp

chr01:20193747..20193828 (+ strand) : 82 bp

chr01:20193924..20194056 (+ strand) : 133 bp

chr01:20194159..20194230 (+ strand) : 72 bp

chr01:20194341..20194463 (+ strand) : 123 bp

chr01:20194541..20194654 (+ strand) : 114 bp

chr01:20194728..20194940 (+ strand) : 213 bp

chr01:20195034..20195132 (+ strand) : 99 bp

chr01:20195218..20195378 (+ strand) : 161 bp

chr01:20195479..20195575 (+ strand) : 97 bp

chr01:20195718..20195879 (+ strand) : 162 bp

chr01:20195958..20196038 (+ strand) : 81 bp

chr01:20196132..20196210 (+ strand) : 79 bp

chr01:20196304..20196440 (+ strand) : 137 bp

chr01:20196528..20196578 (+ strand) : 51 bp

chr01:20196666..20196740 (+ strand) : 75 bp

3'UTR

chr01:20196741..20196937 (+ strand) : 197 bp

FASTA

>Os01t0544450-01 class=Sequence position=chr01:20192025..20196937 (+ strand)
TGCTCTCTCT GCTCGCGCGG AAGCCATGGC GTCTCGCGGC GGTGGCGGCG GCGGCGACGG CAATTCCCCT CCTCCCTGTA
AGATCCAACT GCGATTCTCT CCTCTGATTT TCTCCGGGTG AGGAAGATCT CACTATTTGG GTTTTTGGTT TTGCAGCCGT
GTCGTCGCCG GATGTGCGAC CGTCGAGCCC TCTCCCGGCG ACCAACTCCT CCCCGCCTCA GTCGGGGCGG CGCGGCGGGG
GGCGGCGCCG GCGTGGTTCC GCCAGCCCGT ACCCGTCGTC CCCGTCCCTC GGCGGGTTCG AGACGCCGCC GCACCCGGGC
CGCCGCACGC CCTCCGGCGG CGCGGCGGCG CGGCAGCAGC GGCAGAACTG GACGGGGGGG CGGTTCCCGC CGACCCCGTC
CACCCCCATG TCCACCGACG ACGTCCCGCT CTCCTCGGAG GCCGGGGACG AGGACACCCC CGAGACCGAC GGCGGCGGCG
GCGGCGGCGC GGGCGCCGAC GCCACGCCGG TGTTCGTCTG GGGCACCAAC ATCAGCGTGC AGGACGTCAA CGCCGCCATC
CTCCGGTTCC TCCGCCACTT CCGCGACCCG CGCGACGCCG GCCGCGTCGA CCCGGTCATG GACGAGGGCA AGTACATGCG
CGCCATCCAC CGCATCCTCG AGCTCGAGGG CGGGGAGTCG CTCGACGTCA ACGCCCACGA CGTGTTCGAC CACGACCCGG
ACCTCTACGG CAAGATGGTC AGGTACCCGC TCGAGGTGCT CGCCATCTTT GACATCGTGC TCATGGACCT CGTCGCGCGC
ATCGAGCCCC TCTTCGAGAA GCACATCCAG ACCAGGATCT ACAACCTCAA GTCCTCGGTT TGCTTGAGGA ATCTCAACCC
TTCTGGTGAT TGCGCACTGC TCTGCTCCTT TAGCTACTTG TGGTCGGCAA TTCTTTTATA TGATTTCTGA TTTTGCGTTT
CGTTGCAGAT ATCGAGAAGA TGGTGTCCAT CAAGGGTATG ATAATTCGGT GCAGCTCGGT GATTCCAGAG CTCAAGGAGG
CTGTGTTCCG CTGCTTGGTT TGCGGGTTCT ACTCTGAGCC TGTAATGGTT GATCGAGGTA TATATATATC AGAACTAATG
TGGATACCTT TTTCACACTG CGTATTCCAT ATGCTCTTGT TTTAAGTGAA CTTCAGGTGA TCAATTAATC AGATTGCGAG
CCTTAATTTT GCTCATAGAG AGTTACATAT TGACAACTCA TTGTTAACTT CATTTGTACA AATCATTCTT ATCATGAAAG
ATGATAAATT CAAGCTTCAT TTGACATGTT ATATGTCATT ACTATTATCA TTTATGCATT TTCTTTTATT TTGTTTGCAA
AAACTTTTCA TTTTGTTGGG ATACACAACA TTTAGGAATT TTATTTATCA TACCACATTG CTGAGGAACT GATAAATAGT
GATACTAATT GAGTACGCAA ATCAAACATC CATACTGCTA TTGTCCAATC CAAGACTCCG ACTTAGTCTG TCTGTCATAA
AGTAACACTT TGCACTGTGG TAGTAATTGT AAGTAAAAAC ATGCTTATGT TCTTAACTTA CATTATATTC TGGTGGTTAA
TGTTTGAAGA GATTGGTCAT GCAGATCCTA TGAAAACACA TTAGTGGCCT AGTGGGAGTA ATGACTAAAA CTCCATCAGT
TTCTGTTGTT TTATCATGTA ACTAATTCAC TCTATTTCTT AGGGAGGGTT ACTGAGCCGC ACATCTGTCA GAAAGAACAA
TGTAAAGCTA CAAACTCTAT GACTCTTGTG CATAACCGAT GCAGGTAGCT ATATCCTACT TGTAACCCCT TTTTCTTTAT
AGGATTTTTG ACAGATATGT AGTCCTGACC TTTGGATGGA ACATTTTATT TGTAACTAGG TTTGCAGATA AGCAGATCAT
AAAGTTGCAG GAAACACCAG ATGAGATACC AGAAGGTGGC ACTCCACATA CTGTTAGTGT CTTGATGCAC GATAAGCTTG
TAGATGCTGG AAAGCCTGGA GACAGGGTTG AGGTTAGCAG TGAATCTTTG TTTGGTCATT AATACAAGAA AATAATTTTG
TTTGTGGTTC TTATTCACAT CGTAAAAATC TTGATTTTTT TCTTTGATTT ATAGATAACT GGGATATACA GAGCCATGAG
TATTAGAGTT GGCCCAACTC AGAGGACAGT GAAGTCGATT TTCAAGGTAG AGGATGTGCA ATGTTATCCT ACTTGCTATC
TTAAATTCCT TTTCTGCACA GGAAAAAAGT TTTAAATTAT CTACTCAAGC ATCGTCTAAC AGTTTTCTTT AATCAGACGT
ACATTGATTG CCTTCACATA AAGAAGACAG ACAAGTCTAG ACTTCATGTT GAGGACTCCA TGGAAACTGA TAACCCCAAT
GCTAACAAGA CAACTGAAGA TGATTTTCTC AGAGATAAGG TATCCCTCAA TCACCTTACC TCTCTGGGAT AGCACTAAGT
GTAAATGTGT TTAACACTGT CCTTTCTGTA TTGCAGGTTG AGAAATTAAA AGAGTTGTCA AAGTTGCCAG ATATATATGA
CAGATTAACT AGGTCATTGG CTCCAAACAT ATGGGAGCTG GACGACGTTA AAAGGGGCCT CCTTTGCCAG GTAAGATCAT
CTATCTGTTT GAATGTTTTT GCACTAATAG CCTAGTATAA CAAGCTCTTA CTGTTGTGTC CAGCTTTTTG GTGGAAATGC
TTTGAGGCTT CCTTCTGGAG CTAGTTTCCG AGGCGACATC AATATTTTGC TTGTTGGTGA TCCTGGAACA AGTAAATCCC
AGCTTCTCCA ATACATGCAC AAACTGTCTC CTCGTGGCAT TTATACAAGT GGCAGAGGAA GTTCAGCTGT TGGCCTTACT
GCATACGTTA CCAAGGATCC TGAAACTGGT GAAACTGTAA GTCTACATGA ATCCTTTATT TTCGCAACTT AATTTAACTC
GTTTTAATGT AATCTGATTG ATGACTTCAA CCATGACATC TCATTTCAGG TTCTTGAGAG TGGAGCGCTT GTTTTGAGTG
ACAAAGGTGT TTGTTGTATT GATGAATTTG ATAAGATGTC TGATAATGCT CGAAGCATGT TACATGAGGT CTCTTGTAAT
GCTGCGCCCC AGAATTTGTA TCACACAGTA CTATTTAGTC AATGCTAAAC TGTCCTTTTT CAAAATATTG CAGGTGATGG
AACAACAGAC TGTCTCCATT GCCAAGGCTG GAATAATTGC ATCTTTAAAT GCCAGAACAT CAGTTCTAGC ATGTGCAAAT
CCTACTGAAT CACGTTATAA TCCAAGGCTC TCTGTGATTG ACAATATCCA TCTTCCTCCA ACACTGCTTT CTAGGTGAGT
GCAATGCAAT GTGAATGAGC AATTCTTTCA GGACAAACAG ATCAATAATA GAAGTGTTTT AACTCTTGAT TGTTTTTATT
TTTTTCAAAT TCAGGTTTGA CCTCATTTAT CTGATATTGG ACAAGGCAGA TGAGCAAACT GATAGACGCC TGGCTAAGCA
TATTGTTTCG TTGCATTTTG AGAATCCAAA CGTAAACACA ACAACTCCTT TTCTTCCTGA AGTTTGTACT TTTTTACTTA
TTTGATATAA ACTGCTAACC GTCTTGCAAA TCAGAACACT GTTGTTAGCT TTAGCCTATT TCTTATTAAT TGTGCATTCT
TTCTGCTATC TAGATAGAGG AGCTCGAGGT CTTGGATTTG CCAACACTTG TAGCCTACAT AAGTTATGCA AGGAAGCATA
TACAACCACA GTTATCTGAT GAAGCTGCAG AAGAATTGAC TCGCGGCTAT GTTGAGATGA GGAAAAGAGG AAACAGCCCT
GGTAGCAGAA AGAAGGTAGT GTAGGCTTTT TAATATGATA TTTTTAGCCA TTAAATGGTA CAAGTGACTG ATGCTTTTTT
GCTTATTGTA TAGGTCATAA CTGCGACAGC TCGACAAATT GAGAGCTTGA TTCGGCTCAG TGAAGCACTG GCCCGAATGC
GATTCTCTGA AATGGTAATG ATCATTCCTT ATTCCTAGTT GTCTTGGCTT CACAGCATAA TTCTGGTTAC TTTGGTACTC
ATGATTTCAT TCTTCACTTG TCTACAGGTT GAAGTACAAG ATGTTGTAGA GGCCTTCAGG CTTCTCGAAG TTGCCATGCA
GCAATCGGCA ACTGATCATG CCACTGGTCA GACAATTCTG CTTAGCGCCA TTTCCTATGC ATTTTTTTCT TGTAACCATA
ACATAAAGTG CTGACATTTT TATCAATCAA CCACTAAAGG TACAATCGAT ATGGATCTTA TCATGACTGG AATATCTGCG
AGCGAAAGGC AGAGGCGGGA CAATCTCGTT GCAGCAACCC GCAACCTTGT GATGGAGAAA ATGCAGCTTG GAGGGCCCTC
AGTGCGAATG ATTGAGGTAA AGAACCTTCA ATTAGTGTCC TTTGTTCTCA TCATTGTTTG CCAAACCAGT GGACTAAGTT
ATTCTTCCTG ATTGATTTCG CAGTTGCTGG AAGAAATTAG GAAGCAGAGC TCTATGGAAG TTCATCTGCA TGATGTAAGT
TGGAGATCTA GTCTGCATTG CTTGCATTGA CCTGATACCC TGGGAGGCTC TAACCCATTC CTGAATTTTC CATCTTCTCA
GCTTCGCGGT GCTCTTGGCA CTCTGATGAC AGAGGGTGCC GTAGTCATCC ATGGAGACAG CGTCAAGAGG GTCTGATGCC
TTATTATTTG CGATCTCTCT AGCTAATGTT CTGATCCGTT GTTAGTGCTC TCAATTGGAG ACTGCTTACA CATCGGACTT
ATTGTCTAAC TGTATAATTT TTAGATAATG TTTCTTGTTA CGGTTGCTTA CATGAAAACA AGCAAGTGTT AATCAGAGTT
GTAATGTAAT GCATCAGTTT CCTTTTAGTC AAC

Locus: Os01g0544450

Loading...

Locus: Os01g0544450

Loading...