Os01t0546000-01

Locus

Os01g0546000

Description

Similar to predicted protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsLysM-RLK3, LysM-RLK3, OsLYK1, LYK1

Oryzabase Gene Name Synonym(s)

LysM receptor-like kinase 3, LysM-type receptor-like kinase1

Transcript Evidence

AK241340 (DDBJ, Best hit)

Protein Evidence

D3KU53 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Biological Process: cell wall macromolecule catabolic process (GO:0016998)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein serine/threonine kinase activity (GO:0004674)

Molecular Function: protein tyrosine kinase activity (GO:0004713)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase, catalytic domain (IPR000719)

Serine-threonine/tyrosine-protein kinase (IPR001245)

Serine/threonine-protein kinase, catalytic domain (IPR002290)

Peptidoglycan-binding Lysin subgroup (IPR002482)

Serine/threonine-protein kinase, active site (IPR008271)

Protein kinase-like domain (IPR011009)

Protein kinase, ATP binding site (IPR017441)

Peptidoglycan-binding lysin domain (IPR018392)

Tyrosine-protein kinase, catalytic domain (IPR020635)

Full-length cDNA

J065146O13 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0546000-01)

Others

Oryzabase (10922)

KEGG (Os01t0546000-01 (EC:2.7.11.1))

Transcript

1643 bp

>Os01t0546000-01 Similar to predicted protein.
TTGTCTTATGCAGTTCAGGATGGAGATACCTTGGGCAACATCGCAAGCTTGTTCAGATCG
AGTTGGAAAGATATCTTGGATTTGAACCCAAGAGTCGCAAATCCTGATTTCATAAAGCCA
GGATGGATCTTGTTTATCCCGATGGGAGTTGCTGGTCCTTCTAACAAGAAGGTTCGTGGC
TTACCAATCATAATAGCAGCATCCATATCAGTTGCCATGTTGCTCCTATGTGTGTTAACC
ATCATACTTTGCCTGAAAAGGAGATCTACTCTGCCCAGTGTTGAAGCACCAGCGCATAAA
ATGGAGAAAATTCCCAGTAATACAAGCATTGCTGCACTGGAGAGTCGTTTCTATCCATCC
ATGAGAATCAATGAAATTGATCCATTCCAAACAGAGAGGCCTGTGATTTTCAGCTTGAGA
GCAATTGAAGATGCTACATCTAATTTTGATGAGAAGAGGAAGATTGGTGAGGGAGGATAT
GGAAGTGTCTACCTCGGTTTCATAGGAACACACGAAATAGCAGTCAAGAAGATGAAAGCA
AGCAAATCAAAGGAGTTCTTTGCTGAGTTGAAAGTGCTGTGCAAAATACATCACATAAAT
GTGGTTGAATTGATTGGTTATGCTGCTGGGGATGATCATCTTTACCTCGTTTATGAGTAT
GTCCAGAATGGATCGCTTAGTGAACATCTCCATGATCCTTTGCTGAAAGGCCACCAACCT
CTATCATGGACTGCAAGAACACAGATAGCAATGGACTCTGCACGTGGTATTGAATACATC
CATGATCATACAAAGACCTGCTATGTGCACCGTGACATCAAAACCAGCAATATTCTGCTA
GACAATGGTCTACGAGCTAAAGTGAGCCCATGCAAAACCCATCAATTTTCAGGTATGTCT
GCTCAGATATTCCATCTGTTTGATTATCTTTTGTTTAACAGGTTGCAGATTTCGGCTTGG
TCAAGCTCGTTCAGCGTAGTGATGAAGATGAATGTCTGGCAACTCGTTTGGTTGGAACGC
CAGGCTACCTTCCACCAGAATCAGTTCTTGAGCTTCACATGACTACCAAATCCGATGTGT
ATGCATTCGGAGTAGTTCTTGCAGAGCTTATTACTGGTCTCCGTGCACTTGTACGGGACA
ACAAGGAAGCTAACAAGACAAAATCTCTAATCTCAATCATGAGGAAAGCATTCAAACCAG
AAGATCTGGAGAGTTCCCTGGAGACAATTGTAGATCCCTACCTGAAGGACAATTACCCCA
TAGAAGAAGTTTGCAAGTTGGCAAACATTTCGATGTGGTGCCTCAGTGAGGATCCACTGC
ACCGCCCTGAAATGAGGGAGGTTATGCCGATTTTGGCTCAAATTCATATGGCTTCCATAG
AGTGGGAAGCATCACTCGGAGGCGATGGTGAAGTCTTCAGTGGCGTTTCCAATGGTAGAT
GATGGAGCAGCATTGCTTTGGTAATTGGTACAGAGAAGAATGCACTCCTTGTTTTTATTA
ATTTGGAGAGCTATTTGTTGTAGTGCATTTTGGGAATTTATATACTGTGTTCCTCACTAA
CTGTTGATGTAATATGTTTATATTGGACACTCCCTTTCCAAGCAGTTTCAGTAGCGACCA
AATTAGTCATCaaattctttaaa

CDS

1062 bp

>Os01t0546000-01 Similar to predicted protein.
TTGTCTTATGCAGTTCAGGATGGAGATACCTTGGGCAACATCGCAAGCTTGTTCAGATCG
AGTTGGAAAGATATCTTGGATTTGAACCCAAGAGTCGCAAATCCTGATTTCATAAAGCCA
GGATGGATCTTGTTTATCCCGATGGGAGTTGCTGGTCCTTCTAACAAGAAGGTTCGTGGC
TTACCAATCATAATAGCAGCATCCATATCAGTTGCCATGTTGCTCCTATGTGTGTTAACC
ATCATACTTTGCCTGAAAAGGAGATCTACTCTGCCCAGTGTTGAAGCACCAGCGCATAAA
ATGGAGAAAATTCCCAGTAATACAAGCATTGCTGCACTGGAGAGTCGTTTCTATCCATCC
ATGAGAATCAATGAAATTGATCCATTCCAAACAGAGAGGCCTGTGATTTTCAGCTTGAGA
GCAATTGAAGATGCTACATCTAATTTTGATGAGAAGAGGAAGATTGGTGAGGGAGGATAT
GGAAGTGTCTACCTCGGTTTCATAGGAACACACGAAATAGCAGTCAAGAAGATGAAAGCA
AGCAAATCAAAGGAGTTCTTTGCTGAGTTGAAAGTGCTGTGCAAAATACATCACATAAAT
GTGGTTGAATTGATTGGTTATGCTGCTGGGGATGATCATCTTTACCTCGTTTATGAGTAT
GTCCAGAATGGATCGCTTAGTGAACATCTCCATGATCCTTTGCTGAAAGGCCACCAACCT
CTATCATGGACTGCAAGAACACAGATAGCAATGGACTCTGCACGTGGTATTGAATACATC
CATGATCATACAAAGACCTGCTATGTGCACCGTGACATCAAAACCAGCAATATTCTGCTA
GACAATGGTCTACGAGCTAAAGTGAGCCCATGCAAAACCCATCAATTTTCAGGTATGTCT
GCTCAGATATTCCATCTGTTTGATTATCTTTTGTTTAACAGGTTGCAGATTTCGGCTTGG
TCAAGCTCGTTCAGCGTAGTGATGAAGATGAATGTCTGGCAACTCGTTTGGTTGGAACGC
CAGGCTACCTTCCACCAGAATCAGTTCTTGAGCTTCACATGA

Protein

354 aa

>Os01t0546000-01 Similar to predicted protein.
LSYAVQDGDTLGNIASLFRSSWKDILDLNPRVANPDFIKPGWILFIPMGVAGPSNKKVRG
LPIIIAASISVAMLLLCVLTIILCLKRRSTLPSVEAPAHKMEKIPSNTSIAALESRFYPS
MRINEIDPFQTERPVIFSLRAIEDATSNFDEKRKIGEGGYGSVYLGFIGTHEIAVKKMKA
SKSKEFFAELKVLCKIHHINVVELIGYAAGDDHLYLVYEYVQNGSLSEHLHDPLLKGHQP
LSWTARTQIAMDSARGIEYIHDHTKTCYVHRDIKTSNILLDNGLRAKVSPCKTHQFSGMS
AQIFHLFDYLLFNRLQISAWSSSFSVVMKMNVWQLVWLERQATFHQNQFLSFT*

CDS

chr01:20284942..20285110 (+ strand) : 169 bp

chr01:20285408..20285611 (+ strand) : 204 bp

chr01:20285689..20285828 (+ strand) : 140 bp

chr01:20285925..20286014 (+ strand) : 90 bp

chr01:20286139..20286244 (+ strand) : 106 bp

chr01:20286434..20286763 (+ strand) : 330 bp

chr01:20286838..20286860 (+ strand) : 23 bp

3'UTR

chr01:20286861..20286976 (+ strand) : 116 bp

chr01:20287113..20287211 (+ strand) : 99 bp

chr01:20287301..20287666 (+ strand) : 366 bp

FASTA

>Os01t0546000-01 class=Sequence position=chr01:20284942..20287666 (+ strand)
TTGTCTTATG CAGTTCAGGA TGGAGATACC TTGGGCAACA TCGCAAGCTT GTTCAGATCG AGTTGGAAAG ATATCTTGGA
TTTGAACCCA AGAGTCGCAA ATCCTGATTT CATAAAGCCA GGATGGATCT TGTTTATCCC GATGGGAGTT GCTGGTCCTT
CTAACAAGAG TGAGTCACTG TTTCTTTTCA ACTGATGTTT TTATTTATTT ATTTTCTGCA GTACTGAAAA CTGATACATA
AGGCTTCATG AGAACAAGTA TAAATGGTAC TGTGGACATG ATATTAGATT TAGTGAGACA CAATAAGCAG ATGGCTCCAC
GATTGCTCTT CAAGTTTACA AACCGAAGCT AATTTTCTTT TGATCACAGG ATCTCAACTA CTGTGAAATT TGTGTGTACT
ACTTTTTGCT CCTTTCTAAC TGGATGCTGA ACCTTTGCAT CTCCTTTCTT TGTTTGATGA TTTTAGAGGT TCGTGGCTTA
CCAATCATAA TAGCAGCATC CATATCAGTT GCCATGTTGC TCCTATGTGT GTTAACCATC ATACTTTGCC TGAAAAGGAG
ATCTACTCTG CCCAGTGTTG AAGCACCAGC GCATAAAATG GAGAAAATTC CCAGTAATAC AAGCATTGCT GCACTGGAGA
GTCGTTTCTA TCCATCCATG AGAATCAATG GTCTTGTTCT TCTACCTTTA TTCGTGTTTT TAGTAAAAAT ACATCCTTAT
TAATATTATT GAGTTGATTG GTTGCAGAAA TTGATCCATT CCAAACAGAG AGGCCTGTGA TTTTCAGCTT GAGAGCAATT
GAAGATGCTA CATCTAATTT TGATGAGAAG AGGAAGATTG GTGAGGGAGG ATATGGAAGT GTCTACCTCG GTTTCATAGG
AACACACGTA AGAAGTTTCT AAAGTATCTT GCAAAGGTTA CTATAATCAC AAAGCAGTAT TAGATGATCA TATCCCTATT
CGAAATTGGG ACCTTCATTG CAGGAAATAG CAGTCAAGAA GATGAAAGCA AGCAAATCAA AGGAGTTCTT TGCTGAGTTG
AAAGTGCTGT GCAAAATACA TCACATAAAT GTGGTACGTA GTTAGTTACC AGGAGGGAGG TGATGATTGA TGGAATGATT
TTTTGTTTTC TCAAACACAT GATTGATGTA ATGTGAAGAA AGTTTTTCTT TAACATTTTC AATTCTATTT TACATAGGTT
GAATTGATTG GTTATGCTGC TGGGGATGAT CATCTTTACC TCGTTTATGA GTATGTCCAG AATGGATCGC TTAGTGAACA
TCTCCATGAT CCTTTGCTGA AAGGTATGTA TTAAAATGAG AACCAGCATT TTATTTTGAG GTAACAATTG TTATTGATGT
TCCAAAAGCA AACTATATAT TTGGTAAAAC TTGCAGAATT ATCAATGGAG CACCTGTTTC TCATATTACA TGAGCATGTG
TGTTGCCCTT ATTTAAGACT TACATCAACT CTCTTTCATG TGATATTTAT AGGCCACCAA CCTCTATCAT GGACTGCAAG
AACACAGATA GCAATGGACT CTGCACGTGG TATTGAATAC ATCCATGATC ATACAAAGAC CTGCTATGTG CACCGTGACA
TCAAAACCAG CAATATTCTG CTAGACAATG GTCTACGAGC TAAAGTGAGC CCATGCAAAA CCCATCAATT TTCAGGTATG
TCTGCTCAGA TATTCCATCT GTTTGATTAT CTTTTGTTTA ACAGGTTGCA GATTTCGGCT TGGTCAAGCT CGTTCAGCGT
AGTGATGAAG ATGAATGTCT GGCAACTCGT TTGGTTGGAA CGCCAGGCTA CCTTCCACCA GAGTTAGTTT TGATTTACAT
CTACTTGAGA TGATGGTGTT TCACATGTAG TAGCACTAAT ATCATTAATC CTGCAGATCA GTTCTTGAGC TTCACATGAC
TACCAAATCC GATGTGTATG CATTCGGAGT AGTTCTTGCA GAGCTTATTA CTGGTCTCCG TGCACTTGTA CGGGACAACA
AGGAAGCTAA CAAGACAAAA TCTCTAATCT CAATCGTAAG ATCTGTTGCA GCCAGTTTTG AATGTTTCAG CAGAATTGTT
GTTTCTCCGA TTGGCACACT GATCTTTACC CAAGTGTGCT CAATATATAT TTAATGAAAT CAAAGGATCA AATTGGCCAT
TTTGTGGACA GATGAGGAAA GCATTCAAAC CAGAAGATCT GGAGAGTTCC CTGGAGACAA TTGTAGATCC CTACCTGAAG
GACAATTACC CCATAGAAGA AGTTTGCAAG GTTAGAAACA CTGAAAGTTT GCATTCCTAT TGATTCAGTA ACCATCCCAG
TTAATTGACC GATAATAAGT TTTTTTTTTT GTGATTTAGT TGGCAAACAT TTCGATGTGG TGCCTCAGTG AGGATCCACT
GCACCGCCCT GAAATGAGGG AGGTTATGCC GATTTTGGCT CAAATTCATA TGGCTTCCAT AGAGTGGGAA GCATCACTCG
GAGGCGATGG TGAAGTCTTC AGTGGCGTTT CCAATGGTAG ATGATGGAGC AGCATTGCTT TGGTAATTGG TACAGAGAAG
AATGCACTCC TTGTTTTTAT TAATTTGGAG AGCTATTTGT TGTAGTGCAT TTTGGGAATT TATATACTGT GTTCCTCACT
AACTGTTGAT GTAATATGTT TATATTGGAC ACTCCCTTTC CAAGCAGTTT CAGTAGCGAC CAAATTAGTC ATCaaattct
ttaaa

Locus: Os01g0546000

Loading...

Locus: Os01g0546000

Loading...