Os01t0546800-01

Locus

Os01g0546800

Description

Pectate lyase-like protein, Leaf senescence

RAP-DB Gene Symbol Synonym(s)

OsPSE1, OsPLL1

RAP-DB Gene Name Synonym(s)

premature senescence1, Pectate lyase-like 1

CGSNL Gene Symbol

PSE1

CGSNL Gene Name

PREMATURE SENESCENCE 1

Oryzabase Gene Symbol Synonym(s)

OsPSE1, OsPLL1, PLL1

Oryzabase Gene Name Synonym(s)

premature senescence 1, premature senescence1, Pectate lyase-like 1

Transcript Evidence

AK066636

Protein Evidence

Q8RYR4

Literature

PMID: 29943288

PMID: 23624440

Note

Manual Curation

June 28, 2018

Functional domain (InterPro)

Pectin lyase fold (IPR012334)

Pectin lyase fold/virulence factor (IPR011050)

AmbAllergen (IPR018082)

Pectate lyase (IPR002022)

Full-length cDNA

J013073B06 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0546800-01)

RiceXPro (AK066636)

Others

Oryzabase (21859)

KEGG (Os01t0546800-01 (EC:4.2.2.2))

Transcript

1478 bp

>Os01t0546800-01 Pectate lyase-like protein, Leaf senescence
CTCCGCCACGCCGCACGTCTTCCCTTCGACTCCGCTTCTCCACCGACGCCACCACTGTCC
TTCTCGCTTGCCGTGCCTCATCACCGCCGCACCGCTTCTCTCCGTTTGGTCAGATCTCAG
ATCCAAATTTGAGCTAGTACTAACATTTTTGTGTCGCGTTGGTTTAGTTTTAATCCGATC
CGATCCGCACCGCACGGCACGGCGGCGCGGCCATCTAGCGCCGCCATGGGCGCCTCCTGC
TCCTCCCCCTTCCCCCCTCCTCCTTCACCTGCCGAATCCAACGCCCCCTCCGCCTCCGCG
ATGCACCACCCGCCTCACCCCGCGGCCGGAGGAGGAGGACCCGTCATGCCGTACGCCGAC
GCCGACCGCACCCTCCgcgcgctggccggcgcggcggagggcttcggccgccgcgccatc
ggcgggctccacggcccgctctaccgcgtcacctccctcgacgacgacggccacggcacc
ctccgccaggcgtgccgcgcccacggcccgctctggatcgtcttcgacgtctccggcgac
atccacctccgcacctacctccgcgtcacctcccacaagaccatcgacgggcgcggccag
cgcgtgcgcctcctgggcaaggggctccagctcaaggagtgccgccacgtgatcgtctgc
aacctccagatcgagggcgggcgcggccacgacgtggacgccatccagatcaagccctcc
tccgccgacatctggatcgaccgctgcagcctcgccgactgcgacgacggcctcgtggac
atcacccgcgggagcaccgacgtcaccgtctcccggtgccgcttctcccgccacgaCAAG
ACCATGCTGGTGGGCGCCGACCCGTCCCACACCGGCGACCGCGGCATCCGCGTCACCGTC
CACCACTGCTTCTTCGACGGcacgcggcagcgccacccgcgggtgcggttcgggagggcg
cacctgtacaacaactacacgagggggtggggcatctacgcggtggccgccggggtggag
gcgcaggtggcgtcgcagtgcaacgtgtacgaggccggggcggagaggaaggcggtgttc
aggtacgtgccggagagggcggcggaccgggaggaggcggaggccgggtgggtgaggtcg
gagggggacgccttcctcaacggggcgcggccgtgcctggtggacggcggcgacgcggcg
gtgttcaggccggaggagtactacgagaggtggaccatggaggcggcgtcgccggcgctc
aaggaggtgGTGCAGCTGTGCGCCGGGTGGCAGCCCGTGCCGAGGCCACCGGGCGAGTGA
TCCATCCATCCATGTTACTAGTGTATATCAAAAAGAAATATTCATGTATTATCCATTTAG
TGTGTCAGTACATCATTACCAAGTAATAATCGTGTAATAATCATGCACGTGTGTAATCCT
CATAAAATAAGTTTAAGCAATGAATTTAACCCACAATC

CDS

1095 bp

>Os01t0546800-01 Pectate lyase-like protein, Leaf senescence
ATGGGCGCCTCCTGCTCCTCCCCCTTCCCCCCTCCTCCTTCACCTGCCGAATCCAACGCC
CCCTCCGCCTCCGCGATGCACCACCCGCCTCACCCCGCGGCCGGAGGAGGAGGACCCGTC
ATGCCGTACGCCGACGCCGACCGCACCCTCCgcgcgctggccggcgcggcggagggcttc
ggccgccgcgccatcggcgggctccacggcccgctctaccgcgtcacctccctcgacgac
gacggccacggcaccctccgccaggcgtgccgcgcccacggcccgctctggatcgtcttc
gacgtctccggcgacatccacctccgcacctacctccgcgtcacctcccacaagaccatc
gacgggcgcggccagcgcgtgcgcctcctgggcaaggggctccagctcaaggagtgccgc
cacgtgatcgtctgcaacctccagatcgagggcgggcgcggccacgacgtggacgccatc
cagatcaagccctcctccgccgacatctggatcgaccgctgcagcctcgccgactgcgac
gacggcctcgtggacatcacccgcgggagcaccgacgtcaccgtctcccggtgccgcttc
tcccgccacgaCAAGACCATGCTGGTGGGCGCCGACCCGTCCCACACCGGCGACCGCGGC
ATCCGCGTCACCGTCCACCACTGCTTCTTCGACGGcacgcggcagcgccacccgcgggtg
cggttcgggagggcgcacctgtacaacaactacacgagggggtggggcatctacgcggtg
gccgccggggtggaggcgcaggtggcgtcgcagtgcaacgtgtacgaggccggggcggag
aggaaggcggtgttcaggtacgtgccggagagggcggcggaccgggaggaggcggaggcc
gggtgggtgaggtcggagggggacgccttcctcaacggggcgcggccgtgcctggtggac
ggcggcgacgcggcggtgttcaggccggaggagtactacgagaggtggaccatggaggcg
gcgtcgccggcgctcaaggaggtgGTGCAGCTGTGCGCCGGGTGGCAGCCCGTGCCGAGG
CCACCGGGCGAGTGA

Protein

364 aa

>Os01t0546800-01 Pectate lyase-like protein, Leaf senescence
MGASCSSPFPPPPSPAESNAPSASAMHHPPHPAAGGGGPVMPYADADRTLRALAGAAEGF
GRRAIGGLHGPLYRVTSLDDDGHGTLRQACRAHGPLWIVFDVSGDIHLRTYLRVTSHKTI
DGRGQRVRLLGKGLQLKECRHVIVCNLQIEGGRGHDVDAIQIKPSSADIWIDRCSLADCD
DGLVDITRGSTDVTVSRCRFSRHDKTMLVGADPSHTGDRGIRVTVHHCFFDGTRQRHPRV
RFGRAHLYNNYTRGWGIYAVAAGVEAQVASQCNVYEAGAERKAVFRYVPERAADREEAEA
GWVRSEGDAFLNGARPCLVDGGDAAVFRPEEYYERWTMEAASPALKEVVQLCAGWQPVPR
PPGE*

5'UTR

chr01:20319131..20319355 (- strand) : 225 bp

CDS

chr01:20318036..20319130 (- strand) : 1095 bp

3'UTR

chr01:20317878..20318035 (- strand) : 158 bp

FASTA

>Os01t0546800-01 class=Sequence position=chr01:20317878..20319355 (- strand)
CTCCGCCACG CCGCACGTCT TCCCTTCGAC TCCGCTTCTC CACCGACGCC ACCACTGTCC TTCTCGCTTG CCGTGCCTCA
TCACCGCCGC ACCGCTTCTC TCCGTTTGGT CAGATCTCAG ATCCAAATTT GAGCTAGTAC TAACATTTTT GTGTCGCGTT
GGTTTAGTTT TAATCCGATC CGATCCGCAC CGCACGGCAC GGCGGCGCGG CCATCTAGCG CCGCCATGGG CGCCTCCTGC
TCCTCCCCCT TCCCCCCTCC TCCTTCACCT GCCGAATCCA ACGCCCCCTC CGCCTCCGCG ATGCACCACC CGCCTCACCC
CGCGGCCGGA GGAGGAGGAC CCGTCATGCC GTACGCCGAC GCCGACCGCA CCCTCCgcgc gctggccggc gcggcggagg
gcttcggccg ccgcgccatc ggcgggctcc acggcccgct ctaccgcgtc acctccctcg acgacgacgg ccacggcacc
ctccgccagg cgtgccgcgc ccacggcccg ctctggatcg tcttcgacgt ctccggcgac atccacctcc gcacctacct
ccgcgtcacc tcccacaaga ccatcgacgg gcgcggccag cgcgtgcgcc tcctgggcaa ggggctccag ctcaaggagt
gccgccacgt gatcgtctgc aacctccaga tcgagggcgg gcgcggccac gacgtggacg ccatccagat caagccctcc
tccgccgaca tctggatcga ccgctgcagc ctcgccgact gcgacgacgg cctcgtggac atcacccgcg ggagcaccga
cgtcaccgtc tcccggtgcc gcttctcccg ccacgaCAAG ACCATGCTGG TGGGCGCCGA CCCGTCCCAC ACCGGCGACC
GCGGCATCCG CGTCACCGTC CACCACTGCT TCTTCGACGG cacgcggcag cgccacccgc gggtgcggtt cgggagggcg
cacctgtaca acaactacac gagggggtgg ggcatctacg cggtggccgc cggggtggag gcgcaggtgg cgtcgcagtg
caacgtgtac gaggccgggg cggagaggaa ggcggtgttc aggtacgtgc cggagagggc ggcggaccgg gaggaggcgg
aggccgggtg ggtgaggtcg gagggggacg ccttcctcaa cggggcgcgg ccgtgcctgg tggacggcgg cgacgcggcg
gtgttcaggc cggaggagta ctacgagagg tggaccatgg aggcggcgtc gccggcgctc aaggaggtgG TGCAGCTGTG
CGCCGGGTGG CAGCCCGTGC CGAGGCCACC GGGCGAGTGA TCCATCCATC CATGTTACTA GTGTATATCA AAAAGAAATA
TTCATGTATT ATCCATTTAG TGTGTCAGTA CATCATTACC AAGTAATAAT CGTGTAATAA TCATGCACGT GTGTAATCCT
CATAAAATAA GTTTAAGCAA TGAATTTAAC CCACAATC

Locus: Os01g0546800

Loading...

Locus: Os01g0546800

Loading...