Os01t0549700-01

Locus

Os01g0549700

Description

Member of the DExD/H-box family of helicases, DEAD-box ATP-dependent RNA helicase, RNA and DNA metabolism, Response to abiotic stress including salt stress and abscisic acid, Regulation of programmed cell death (PCD) during tapetum degeneration

RAP-DB Gene Symbol Synonym(s)

OsBAT1, UAP56, OsBAT1/UAP56, OsAIP1, Os AIP1

RAP-DB Gene Name Synonym(s)

HLA-B associated transcript 1, spliceosome RNA helicase UAP56, API5-INTERACTING PROTEIN1

CGSNL Gene Symbol

AIP1

CGSNL Gene Name

API5-INTERACTING PROTEIN 1

Oryzabase Gene Symbol Synonym(s)

AIP1, Os AIP1, OsAIP1, OsRH56, OsBAT1, UAP56, OsUAP56, OsBAT1/UAP56

Oryzabase Gene Name Synonym(s)

API5-INTERACTING PROTEIN1, RNA helicase 56, HLA-B associated transcript 1, spliceosome RNA helicase UAP56

Transcript Evidence

AK067431

Protein Evidence

Q0JM17

Literature

PMID: 25772680

PMID: 21467577

Note

Manual Curation

July 27, 2020

Gene Ontology (GO)

Molecular Function: nucleic acid binding (GO:0003676)

Molecular Function: ATP binding (GO:0005524)

Functional domain (InterPro)

P-loop containing nucleoside triphosphate hydrolase (IPR027417)

RNA helicase, DEAD-box type, Q motif (IPR014014)

Helicase superfamily 1/2, ATP-binding domain (IPR014001)

DEAD/DEAH box helicase domain (IPR011545)

Helicase, C-terminal (IPR001650)

Experimentally confirmed subcellular location

nucleus (GO:0005634)

cytoplasm (GO:0005737)

Full-length cDNA

J013107H03 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0549700-01)

RiceXPro (AK067431)

Others

Oryzabase (9251)

KEGG (Os01t0549700-01 (EC:3.6.4.13))

Transcript

1863 bp

>Os01t0549700-01 Member of the DExD/H-box family of helicases, DEAD-box ATP-dependent RNA helicase, RNA and DNA metabolism, Response to abiotic stress including salt stress and abscisic acid, Regulation of programmed cell death (PCD) during tapetum degeneration
CCACACCCCAAATTCCAAATCGCTACCTCCCCCAAGAACCCTAGCTCCCTCTCCCCCCCT
CTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTTTGCAGCCGCCGCCGCCG
CCGCCGCCGCCGCCGCCGCGTCCGCTTCGACTCCCGCCGCCAGGTTCTCTCTCTCCAGCG
CGCAGGCACCATGGCCGAAGCCGAGGTTAAGGACAACGAGGTTTACGAGGAGGATCTCGT
CGACTACGAGGAGGAGGTGGAGAACGGCACCGACGGTGGCGCCAACGCCGCCAACGCCTC
CGCCGATGTCGTCAAGAAGGGGTACGTGGGGATCCACAGCTCGGGGTTCAGAGACTTCCT
GCTCAAGCCGGAGCTGCTTCGCGCCATCCAGGACTGCGGGTTTGAGCACCCTTCCGAAGT
GCAACACGAATGCATCCCACAAGCCATTCTTGGAATGGATGTCATCTGCCAAGCAAAATC
TGGGATGGGGAAGACTGCTGTTTTTGTTCTCTCAAGTCTTCAGCAAATTGATCCTGTTGC
TGGTCAAGTTGGTGCACTTGTGCTATGTCACACAAGGGAGCTAGCTTACCAGATTTGCCA
TGAATTTGAGAGGTTTAGCAAGTACCTTCCTGAGGTAAAAGTTGCGGTCTTCTATGGTGG
TGTTCACATAAAAAAACACAAGGATCTGTTGAAGAATGACTGCCCTCATATTGTGGTTGG
AACACCTGGAAGGATACTAGCTCTAGCTAGAGAGAAGGATCTTTCCTTGAAGAATGTGAG
GCATTTCATTCTTGATGAATGTGACAAGATGCTCGATTCACTTGacatgcgtagagatgt
gcaggagatcttcaaaatgacaccccatgataagcaagtgatgatgttttcagcgaccct
tagcaaggagatccgcccagtttgcaagaaattcatgcaagatcctatggaaatttatgt
tgatgatgaggctaaactgacccttcatgggctagttcagcactatattaaactaagtga
ggcggagaagaaccggaaattgaatgatctcttagatgcactggacttcaatcaagttgt
gatatttgttaaaagtgttagtagagctgcagaactgaacaagctgctttgtgaatgcaa
ctttcctgcgatctccatacattctggaatgacacaggaggagagGCTTACCCGGTACAA
GAACTTCAAGGAAGGACACAAGAGGATTCTTGTGGCTACTGATTTAGTTGGCAGGGGAAT
TGATATTGAACGTGTCAACATTGTCATAAACTATGACATGCCCGATTCTGCTGATTCGTA
TCTACACAGGGTTGGAAGGGCTGGGCGTTTTGGAACCAAAGGACTTGCAATAACATTTGT
TTCCTCTGCCTCTGACTCTGATGTTCTTAATCAAGTGCAAGAAAGATTCGAGGTTGACAT
AAAGGAGCTTCCTGAGCAGATTGATACTTCGACATATATGCCTTCTTAAAGATCCGGGTG
GATTGCTTAAAGCTTACATTCGAACGGAAACGAGAGTATCTCCTTGAGATACGGCATATT
AAGAATCTATCGGATAACTAAAAACTTAGTGTGAGAAATGCTGCCCTATCTATACTTAGA
CAGCAGTTTAGATCTGCTGCTAAGTGCTGAATGCCCCGTAATAATACTTGAAATGATGTA
TCTGGGCAATTGGGCATGTACGTATTTGAATTGCAGTCGTTCATTGTAATTCCGAGAATT
TTATTAGGATTTGTTTGTGTTAATTTTGCTACTCCGCAGATGCTAACGTGGGTTAGTTTA
TAGTACTTTGTTTATGGTACTTTTGAGGATTTCAACCGCGTTTCTTACCGTACATTTTGT
TCC

CDS

1299 bp

>Os01t0549700-01 Member of the DExD/H-box family of helicases, DEAD-box ATP-dependent RNA helicase, RNA and DNA metabolism, Response to abiotic stress including salt stress and abscisic acid, Regulation of programmed cell death (PCD) during tapetum degeneration
ATGGCCGAAGCCGAGGTTAAGGACAACGAGGTTTACGAGGAGGATCTCGTCGACTACGAG
GAGGAGGTGGAGAACGGCACCGACGGTGGCGCCAACGCCGCCAACGCCTCCGCCGATGTC
GTCAAGAAGGGGTACGTGGGGATCCACAGCTCGGGGTTCAGAGACTTCCTGCTCAAGCCG
GAGCTGCTTCGCGCCATCCAGGACTGCGGGTTTGAGCACCCTTCCGAAGTGCAACACGAA
TGCATCCCACAAGCCATTCTTGGAATGGATGTCATCTGCCAAGCAAAATCTGGGATGGGG
AAGACTGCTGTTTTTGTTCTCTCAAGTCTTCAGCAAATTGATCCTGTTGCTGGTCAAGTT
GGTGCACTTGTGCTATGTCACACAAGGGAGCTAGCTTACCAGATTTGCCATGAATTTGAG
AGGTTTAGCAAGTACCTTCCTGAGGTAAAAGTTGCGGTCTTCTATGGTGGTGTTCACATA
AAAAAACACAAGGATCTGTTGAAGAATGACTGCCCTCATATTGTGGTTGGAACACCTGGA
AGGATACTAGCTCTAGCTAGAGAGAAGGATCTTTCCTTGAAGAATGTGAGGCATTTCATT
CTTGATGAATGTGACAAGATGCTCGATTCACTTGacatgcgtagagatgtgcaggagatc
ttcaaaatgacaccccatgataagcaagtgatgatgttttcagcgacccttagcaaggag
atccgcccagtttgcaagaaattcatgcaagatcctatggaaatttatgttgatgatgag
gctaaactgacccttcatgggctagttcagcactatattaaactaagtgaggcggagaag
aaccggaaattgaatgatctcttagatgcactggacttcaatcaagttgtgatatttgtt
aaaagtgttagtagagctgcagaactgaacaagctgctttgtgaatgcaactttcctgcg
atctccatacattctggaatgacacaggaggagagGCTTACCCGGTACAAGAACTTCAAG
GAAGGACACAAGAGGATTCTTGTGGCTACTGATTTAGTTGGCAGGGGAATTGATATTGAA
CGTGTCAACATTGTCATAAACTATGACATGCCCGATTCTGCTGATTCGTATCTACACAGG
GTTGGAAGGGCTGGGCGTTTTGGAACCAAAGGACTTGCAATAACATTTGTTTCCTCTGCC
TCTGACTCTGATGTTCTTAATCAAGTGCAAGAAAGATTCGAGGTTGACATAAAGGAGCTT
CCTGAGCAGATTGATACTTCGACATATATGCCTTCTTAA

Protein

433 aa

>Os01t0549700-01 Member of the DExD/H-box family of helicases, DEAD-box ATP-dependent RNA helicase, RNA and DNA metabolism, Response to abiotic stress including salt stress and abscisic acid, Regulation of programmed cell death (PCD) during tapetum degeneration
MAEAEVKDNEVYEEDLVDYEEEVENGTDGGANAANASADVVKKGYVGIHSSGFRDFLLKP
ELLRAIQDCGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSSLQQIDPVAGQV
GALVLCHTRELAYQICHEFERFSKYLPEVKVAVFYGGVHIKKHKDLLKNDCPHIVVGTPG
RILALAREKDLSLKNVRHFILDECDKMLDSLDMRRDVQEIFKMTPHDKQVMMFSATLSKE
IRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSEAEKNRKLNDLLDALDFNQVVIFV
KSVSRAAELNKLLCECNFPAISIHSGMTQEERLTRYKNFKEGHKRILVATDLVGRGIDIE
RVNIVINYDMPDSADSYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKEL
PEQIDTSTYMPS*

5'UTR

chr01:20540847..20541036 (+ strand) : 190 bp

CDS

chr01:20541037..20541164 (+ strand) : 128 bp

chr01:20541270..20541368 (+ strand) : 99 bp

chr01:20542999..20543173 (+ strand) : 175 bp

chr01:20543255..20543486 (+ strand) : 232 bp

chr01:20543633..20543751 (+ strand) : 119 bp

chr01:20544370..20544426 (+ strand) : 57 bp

chr01:20544505..20544689 (+ strand) : 185 bp

chr01:20546142..20546286 (+ strand) : 145 bp

chr01:20546353..20546436 (+ strand) : 84 bp

chr01:20546524..20546587 (+ strand) : 64 bp

chr01:20546689..20546699 (+ strand) : 11 bp

3'UTR

chr01:20546700..20547073 (+ strand) : 374 bp

FASTA

>Os01t0549700-01 class=Sequence position=chr01:20540847..20547073 (+ strand)
CCACACCCCA AATTCCAAAT CGCTACCTCC CCCAAGAACC CTAGCTCCCT CTCCCCCCCT CTCTCTCTCT CTCTCTCTCT
CTCTCTCTCT CTCTCTCTCT CTTTGCAGCC GCCGCCGCCG CCGCCGCCGC CGCCGCCGCG TCCGCTTCGA CTCCCGCCGC
CAGGTTCTCT CTCTCCAGCG CGCAGGCACC ATGGCCGAAG CCGAGGTTAA GGACAACGAG GTTTACGAGG AGGATCTCGT
CGACTACGAG GAGGAGGTGG AGAACGGCAC CGACGGTGGC GCCAACGCCG CCAACGCCTC CGCCGATGTC GTCAAGAAGT
GCGTACCCCC CAAGGGTTTG CTTTGTTTTC TCTCGCTAGG GTTAGGGTTT CGTGGTTGAG TCGGTTGGAG GGCCCTGATC
TGAACTTCTT CTCTGTTGGA CAGGGGGTAC GTGGGGATCC ACAGCTCGGG GTTCAGAGAC TTCCTGCTCA AGCCGGAGCT
GCTTCGCGCC ATCCAGGACT GCGGGTTTGA GCACCCTTCC GAAGGCAAGC TCATATGCTC TTTTCTTTTT TTCCCCTTGT
TGATGCTACT GCTGCTAGCG TTCCATCCTT TTGGAGGCCT TTAAATTGAA ATCTAAATAA ATGATGTGTG GAGTGGCAAT
CATTTTATTC TGAATTCGAT ATAGTCCGAG TAGTCACTTA AAAACCAACA CTAACCCAGG TGTATATTAA TTTGGTTCAA
GGACTTTATA GATCTATAAA TGGGCTAAAA CTACTAGGAT GGCGTTATCT AAGTGGTAAC TGAAAATTCG AAAGTCACTT
GTGTCACGTG CGTGCCCCTC TGTTTCTTTC ATGTTAATTT CTTATTAATC TTATTTATTT CCTATAATAG CTTCTTACAC
TTATTTATTT CCTGTAATAC CTTAATCAAC CTTCATGCTT GCTACTGCCT CGTTACGTTA TCTGAACGAG CCTTCAAATT
TTGAGCCCAT ATGATGAATA AAAAGGCTTG ATTGGAATTC TTTAAGTAGC ATAGTTAACT GAGTTCGAAT TGTTCTGACC
AGACACAATA CATAGTTGAC AAGCTTGACT AAACTGATGG TTTTACTGGA AAAAAAAGGG GGAAGTAGTG CTTAGATTGG
TCTCGCTGTG AGCTAAGACT GTCAATACAT TTAGACTTAT TTAATTGGAA AAAACAGCAT GCTGAGATTG GTATCACTCT
GGTTGTGCAC TAGGATCATC CTTGCATTTA GACTGCTTTT GGTGGGGAGA AGGGAACCGG TGCTAAGCTG CTTGTGCGTT
AGGACGGTCC ATGCATTTAG ACCGCTTTTG AACTTGGTGG ACTAGGTGGT TTTATGGTCA ACTGGTGTCA AACCAGCACT
GGTTGAACTG GCTGAGCCAG TGATTCACCA AGAAGGAAGA CCCAATGTCT CCTCAAGGGC TCCAACTTCA TTTTACTGTA
AAAAATAGTG AAAATAGCTT GCGGGTGGAG GATTCGCTCT ACGACGGTGG ATGCCAGGTC CTGTTGCCAT CCCACCACCT
CGTCATGTGT GTTTGTATTG AAACATACAT GCAACATAAA CTTTATTGAG CTGTGGACCA CTGGACTGGT GAACCAAGAA
TTTGGCCGGG TCACTGACCA GTTCAACCTT TCATACTATG ATACTGTACT ATATTTAGAT GCCTCGGAGT GAATGCAATA
TATAATTACT GCAAAGGCAA GCAATTGGTT GTTTTTAAGG TGCTATTTTC TCCATTAGCT AACATGGGCA TATGCCATAT
ATATTTAAAC TTTGAATGCA TTCCCTAGGC ATTGATGCAC TTGCCCACTC CACTTTTGCA GCCAGCTCTC CTGTTTCTGG
GACAGTTCAT CTAGAAGTAA CTAAGTATTA ACTCAAACAG AAAACAATAA ATGAATTGAT TGTGCATGAA CATTTGCTCG
TCCTAGTGCT TATTTCTAGT ACCAAATAAG ATTATATACA CTCTAGCATT CATTATTTTT CCATTCTTTC CAAGCGTGTT
AATGAAAACG TCATTTTGCT AATGTGCAGG TACAATTTTA TCTGACAATT TTAGTTGGGA GGAGAATGTG GTAAAAACTT
TCAATTAACG GCGACAGGAG GTTAAATAGT TTCTCACTGG GGTACTGCTC CAATTTTGTT TGGCTCTACA CCAGTGCAAC
ACGAATGCAT CCCACAAGCC ATTCTTGGAA TGGATGTCAT CTGCCAAGCA AAATCTGGGA TGGGGAAGAC TGCTGTTTTT
GTTCTCTCAA GTCTTCAGCA AATTGATCCT GTTGCTGGTC AAGTTGGTGC ACTTGTGCTA TGTCACACAA GGGAGCTAGC
TTACCAGGTA TATATTTATG TCTTAGTTTA ATTATGTCCA ATATGTCTGC ATATACTAAC TGTCTCTTTA CTTAATATAA
TGTTGTAGAT TTGCCATGAA TTTGAGAGGT TTAGCAAGTA CCTTCCTGAG GTAAAAGTTG CGGTCTTCTA TGGTGGTGTT
CACATAAAAA AACACAAGGA TCTGTTGAAG AATGACTGCC CTCATATTGT GGTTGGAACA CCTGGAAGGA TACTAGCTCT
AGCTAGAGAG AAGGATCTTT CCTTGAAGAA TGTGAGGCAT TTCATTCTTG ATGAATGTGA CAAGATGCTC GATTCACTTG
GTAGGCTGCT GTTCCTTGTT CAAGTGACCA TCATTCTACA CCCAGaatat gtttactttg cgataacttt tctaccccta
tttgtatcat atcaatatat catacattgc tctgttatat tcttattaat gcatttgttt cttcagacat gcgtagagat
gtgcaggaga tcttcaaaat gacaccccat gataagcaag tgatgatgtt ttcagcgacc cttagcaagg agatccgccc
agtttgcaag aaattcatgc aagatgtaat gtcatgtggc ctatctcatt tcaatagcgc ttcttcttac tctggcatac
taccatgata tgagtggtgg cagttctgtt gtcagtagat caaagggatt tctgattttt gtacacttct ccattggtcg
tagttcatca attactacct gagtgttcct attggctgca agtgaagtct tctgtcaatg tgaaccatct ggggagaatg
cgggtgttgg ggttgggagg gcaccgttat tgtagattgt acaaggccag tgcggctttt ctccaattgt ctgcatgctt
gaactggact ccgctttatc agagtaaact gcttctgttt ctcctaccct tctcatggtc agtgtggaca aagcagcttc
ctcttgatgc tagttcttgt agcaagcact gccccagaac ttcttctcta tgatttggtc aaatgtcagt gtccattgtc
atagctgaag ttcaaatacc agtgcccaat tcatagctga agttccctta ggaggctcaa aattttgatg caagaagaat
tgatatgcta ttcttattgg tgtggctaga acattggcac acagaaattc taataccttt atctaccatt tgttatctta
cagcctatgg aaatttatgt tgatgatgag gctaaactga cccttcatgg gctagttcag gtactattta attatcaatt
tgtcatttga accacttttc tgtttatttt gtaccaaccc cccgttttct gattccagca ctatattaaa ctaagtgagg
cggagaagaa ccggaaattg aatgatctct tagatgcact ggacttcaat caagttgtga tatttgttaa aagtgttagt
agagctgcag aactgaacaa gctgctttgt gaatgcaact ttcctgcgat ctccatacat tctggaatga cacaggagga
gaggtTTGTT CTCTTGAATT CCTTCGTGGC CTGGTCTTTT AGGTTCTTGT GTTTTGTGCT TGTTTTATCT GTTATTAAAA
TAACAATAAT CTATGCTGAT GGTGGTGGTT GTCTTATTTT ATTTATCTTT TTCTTTGTTG TCATGCTTTA GATGATGTCA
GATATTTCAT CAACCTAATT CAAATCTATA TTTCTAAAGC TGGCGGGTCT CTCGGCCAGC TGATTGGTCG AGCTGGTGGC
TCTATATTTT GTTGACACGT GTAAAGCAAC CGGCGAACAC TCGCGTACAT CCAGAGTCGG AACTCGAGAG AGATCAGGAG
AGGGGAAAAA ATCGAAGCTA GTGAGCCACA TACGCACATA CACCTGGGCC TAGCGCCACA TACGCCTGTT CCAGTTTGCT
CAATGGTGCT ACAAGCTTAC GCCTGTCCTC GCCTCCTCGT GTTTGTCAAC CTGTCAGCCT GAGGGTGTAC AGTAGTAGAA
ACTAGCAAGC AAACATGGTT GACTCAGGTT CTAATGCTTT GTCTTAGCCC AACAACAATC AATCCATCTA TCCTTAGCTA
AAAGTATGTG GTAAAACTTG ATTATATTGG ACCAAATAAC CATCAGGCCC AACTTTACTG AAATGAAAAT AAACAAGTCA
TTTATATACC TCACAAGTAA AAAAATTTTA AATGCAATTC TGAGCATTAA AATCACATTT ATAACTAATT CGTTATACAA
GTACTTCGTT TCAATTAAAG TATAACATAT TCAAATATAT CTTCACAAAA AAATATCGTA GTTTAATTTG AGGTTTTTTG
GAATAATATG ATTTGCTTCA CAATAAAACG AAGCTGAAAA TTCATCAGAA AGTTTTTATC ATAATCTATA TTGAAAATAA
CACATAAATA GTATAACATG GGCTATAAAG TAAACGCGCG AATCGGCGTG TTAATTTCCT AGTGTATTCT ATAATCTGTA
CATTTTTCTG GTGCCTATAA TTGCTTTGTG GGTCAACCAT AGTGCATTAT CCATGTGAGT GTTATGATGT AAGCATGGAT
GGAGTTGACC TATTATTTCA TACGTTCGTA TTTACTTTAT ATTATTTCAA TAGTTATGCC TAATAAAGTT AGCATATCTT
TGAGACATTA AGGAAACTTG TTGAAATTAA CAGCATGCCA CGAAGCAGGA TTCACCTGTG TTTGGTTTAT GCCCTCAATT
GTTGTTCTCT AGACCTTTTA TACTATTATT ATATGAATAC TTTTGTTGGT GGTGATGGTC TGCCTGCCAA CCTACCCTCA
GCCACCACTT TATTGCTGGC AATGAAATAG ACATGATCAG GGTTTCAGAT CATACCACTA TAGCCATTAA ATGATTGAGG
AGTTCTGATA GTTATTCCCT GACCAGTTGT GGCGGTTTGA TCCCTGCCAA GAATCCTTAA TGTTTGATCC TTATCTAATG
ATGGAGCTTT TACAGGCTTA CCCGGTACAA GAACTTCAAG GAAGGACACA AGAGGATTCT TGTGGCTACT GATTTAGTTG
GCAGGGGAAT TGATATTGAA CGTGTCAACA TTGTCATAAA CTATGACATG CCCGATTCTG CTGATTCGTA TCTACACAGG
GTAATTTTAA CATCACTTCA CTGCTTCTCT TTAAGTTCTT TCTCTTGCTG ACATTCTATC CTCCAGGTTG GAAGGGCTGG
GCGTTTTGGA ACCAAAGGAC TTGCAATAAC ATTTGTTTCC TCTGCCTCTG ACTCTGATGT TCTTAATCAA GTTAGTACAA
CTGATCATTT TAATTTTGTT GCTTAACTGG TGTGATGACA AAGCCTCACT GTAATTTCTC ATGCATGATG TTTTAAGGTG
CAAGAAAGAT TCGAGGTTGA CATAAAGGAG CTTCCTGAGC AGATTGATAC TTCGACATAT AGTAAGTGTT GTTTACCTTG
TTATTCCAGA TTAATTTGTA ATACCATATC ATATGATTTG TTCAAAGAAC TGATTTGTTG TATTTTGATT TGTATTTTCC
AGTGCCTTCT TAAAGATCCG GGTGGATTGC TTAAAGCTTA CATTCGAACG GAAACGAGAG TATCTCCTTG AGATACGGCA
TATTAAGAAT CTATCGGATA ACTAAAAACT TAGTGTGAGA AATGCTGCCC TATCTATACT TAGACAGCAG TTTAGATCTG
CTGCTAAGTG CTGAATGCCC CGTAATAATA CTTGAAATGA TGTATCTGGG CAATTGGGCA TGTACGTATT TGAATTGCAG
TCGTTCATTG TAATTCCGAG AATTTTATTA GGATTTGTTT GTGTTAATTT TGCTACTCCG CAGATGCTAA CGTGGGTTAG
TTTATAGTAC TTTGTTTATG GTACTTTTGA GGATTTCAAC CGCGTTTCTT ACCGTACATT TTGTTCC

Locus: Os01g0549700

Loading...

Locus: Os01g0549700

Loading...