Os01t0549700-02

Locus

Os01g0549700

Description

Similar to cDNA clone:J033114G10, full insert sequence.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

AIP1

CGSNL Gene Name

API5-INTERACTING PROTEIN 1

Oryzabase Gene Symbol Synonym(s)

AIP1, Os AIP1, OsAIP1, OsRH56, OsBAT1, UAP56, OsUAP56, OsBAT1/UAP56

Oryzabase Gene Name Synonym(s)

API5-INTERACTING PROTEIN1, RNA helicase 56, HLA-B associated transcript 1, spliceosome RNA helicase UAP56

Transcript Evidence

AK071356 (DDBJ, Best hit)

Protein Evidence

B7F820 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: nucleic acid binding (GO:0003676)

Molecular Function: helicase activity (GO:0004386)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: ATP-dependent helicase activity (GO:0008026)

Functional domain (InterPro)

Helicase, C-terminal (IPR001650)

DNA/RNA helicase, DEAD/DEAH box type, N-terminal (IPR011545)

DEAD-like helicase (IPR014001)

Full-length cDNA

J023097G12 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0549700-02)

RiceXPro (AK071356)

Others

Oryzabase (9251)

KEGG (Os01t0549700-02 (EC:3.6.4.13))

Transcript

1042 bp

>Os01t0549700-02 Similar to cDNA clone:J033114G10, full insert sequence.
TTGATGAATGTGACAAGATGCTCGATTCACTTGacatgcgtagagatgtgcaggagatct
tcaaaatgacaccccatgataagcaagtgatgatgttttcagcgacccttagcaaggaga
tccgcccagtttgcaagaaattcatgcaagatcctatggaaatttatgttgatgatgagg
ctaaactgacccttcatgggctagttcagcactatattaaactaagtgaggcggagaaga
accggaaattgaatgatctcttagatgcactggacttcaatcaagttgtgatatttgtta
aaagtgttagtagagctgcagaactgaacaagctgctttgtgaatgcaactttcctgcga
tctccatacattctggaatgacacaggaggagagGCTTACCCGGTACAAGAACTTCAAGG
AAGGACACAAGAGGATTCTTGTGGCTACTGATTTAGTTGGCAGGGGAATTGATATTGAAC
GTGTCAACATTGTCATAAACTATGACATGCCCGATTCTGCTGATTCGTATCTACACAGGG
TTGGAAGGGCTGGGCGTTTTGGAACCAAAGGACTTGCAATAACATTTGTTTCCTCTGCCT
CTGACTCTGATGTTCTTAATCAAGTGCAAGAAAGATTCGAGGTTGACATAAAGGAGCTTC
CTGAGCAGATTGATACTTCGACATATATGCCTTCTTAAAGATCCGGGTGGATTGCTTAAA
GCTTACATTCGAACGGAAACGAGAGTATCTCCTTGAGATACGGCATATTAAGAATCTATC
GGATAACTAAAAACTTAGTGTGAGAAATGCTGCCCTATCTATACTTAGACAGCAGTTTAG
ATCTGCTGCTAAGTGCTGAATGCCCCGTAATAATACTTGAAATGATGTATCTGGGCAATT
GGGCATGTACGTATTTGAATTGCAGTCGTTCATTGTAATTCCGAGAATTTTATTAGGATT
TGTTTGTGTTAATTTTGCTACTCCGCAGATGCTAACGTGGGTTAGTTTATAGTACTTTGT
TTATGGTACTTTTGAGGATTTC

CDS

696 bp

>Os01t0549700-02 Similar to cDNA clone:J033114G10, full insert sequence.
GATGAATGTGACAAGATGCTCGATTCACTTGacatgcgtagagatgtgcaggagatcttc
aaaatgacaccccatgataagcaagtgatgatgttttcagcgacccttagcaaggagatc
cgcccagtttgcaagaaattcatgcaagatcctatggaaatttatgttgatgatgaggct
aaactgacccttcatgggctagttcagcactatattaaactaagtgaggcggagaagaac
cggaaattgaatgatctcttagatgcactggacttcaatcaagttgtgatatttgttaaa
agtgttagtagagctgcagaactgaacaagctgctttgtgaatgcaactttcctgcgatc
tccatacattctggaatgacacaggaggagagGCTTACCCGGTACAAGAACTTCAAGGAA
GGACACAAGAGGATTCTTGTGGCTACTGATTTAGTTGGCAGGGGAATTGATATTGAACGT
GTCAACATTGTCATAAACTATGACATGCCCGATTCTGCTGATTCGTATCTACACAGGGTT
GGAAGGGCTGGGCGTTTTGGAACCAAAGGACTTGCAATAACATTTGTTTCCTCTGCCTCT
GACTCTGATGTTCTTAATCAAGTGCAAGAAAGATTCGAGGTTGACATAAAGGAGCTTCCT
GAGCAGATTGATACTTCGACATATATGCCTTCTTAA

Protein

232 aa

>Os01t0549700-02 Similar to cDNA clone:J033114G10, full insert sequence.
DECDKMLDSLDMRRDVQEIFKMTPHDKQVMMFSATLSKEIRPVCKKFMQDPMEIYVDDEA
KLTLHGLVQHYIKLSEAEKNRKLNDLLDALDFNQVVIFVKSVSRAAELNKLLCECNFPAI
SIHSGMTQEERLTRYKNFKEGHKRILVATDLVGRGIDIERVNIVINYDMPDSADSYLHRV
GRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS*

5'UTR

chr01:20543454..20543455 (+ strand) : 2 bp

CDS

chr01:20543456..20543486 (+ strand) : 31 bp

chr01:20543633..20543751 (+ strand) : 119 bp

chr01:20544370..20544426 (+ strand) : 57 bp

chr01:20544505..20544689 (+ strand) : 185 bp

chr01:20546142..20546286 (+ strand) : 145 bp

chr01:20546353..20546436 (+ strand) : 84 bp

chr01:20546524..20546587 (+ strand) : 64 bp

chr01:20546689..20546699 (+ strand) : 11 bp

3'UTR

chr01:20546700..20547043 (+ strand) : 344 bp

FASTA

>Os01t0549700-02 class=Sequence position=chr01:20543454..20547043 (+ strand)
TTGATGAATG TGACAAGATG CTCGATTCAC TTGGTAGGCT GCTGTTCCTT GTTCAAGTGA CCATCATTCT ACACCCAGaa
tatgtttact ttgcgataac ttttctaccc ctatttgtat catatcaata tatcatacat tgctctgtta tattcttatt
aatgcatttg tttcttcaga catgcgtaga gatgtgcagg agatcttcaa aatgacaccc catgataagc aagtgatgat
gttttcagcg acccttagca aggagatccg cccagtttgc aagaaattca tgcaagatgt aatgtcatgt ggcctatctc
atttcaatag cgcttcttct tactctggca tactaccatg atatgagtgg tggcagttct gttgtcagta gatcaaaggg
atttctgatt tttgtacact tctccattgg tcgtagttca tcaattacta cctgagtgtt cctattggct gcaagtgaag
tcttctgtca atgtgaacca tctggggaga atgcgggtgt tggggttggg agggcaccgt tattgtagat tgtacaaggc
cagtgcggct tttctccaat tgtctgcatg cttgaactgg actccgcttt atcagagtaa actgcttctg tttctcctac
ccttctcatg gtcagtgtgg acaaagcagc ttcctcttga tgctagttct tgtagcaagc actgccccag aacttcttct
ctatgatttg gtcaaatgtc agtgtccatt gtcatagctg aagttcaaat accagtgccc aattcatagc tgaagttccc
ttaggaggct caaaattttg atgcaagaag aattgatatg ctattcttat tggtgtggct agaacattgg cacacagaaa
ttctaatacc tttatctacc atttgttatc ttacagccta tggaaattta tgttgatgat gaggctaaac tgacccttca
tgggctagtt caggtactat ttaattatca atttgtcatt tgaaccactt ttctgtttat tttgtaccaa ccccccgttt
tctgattcca gcactatatt aaactaagtg aggcggagaa gaaccggaaa ttgaatgatc tcttagatgc actggacttc
aatcaagttg tgatatttgt taaaagtgtt agtagagctg cagaactgaa caagctgctt tgtgaatgca actttcctgc
gatctccata cattctggaa tgacacagga ggagaggtTT GTTCTCTTGA ATTCCTTCGT GGCCTGGTCT TTTAGGTTCT
TGTGTTTTGT GCTTGTTTTA TCTGTTATTA AAATAACAAT AATCTATGCT GATGGTGGTG GTTGTCTTAT TTTATTTATC
TTTTTCTTTG TTGTCATGCT TTAGATGATG TCAGATATTT CATCAACCTA ATTCAAATCT ATATTTCTAA AGCTGGCGGG
TCTCTCGGCC AGCTGATTGG TCGAGCTGGT GGCTCTATAT TTTGTTGACA CGTGTAAAGC AACCGGCGAA CACTCGCGTA
CATCCAGAGT CGGAACTCGA GAGAGATCAG GAGAGGGGAA AAAATCGAAG CTAGTGAGCC ACATACGCAC ATACACCTGG
GCCTAGCGCC ACATACGCCT GTTCCAGTTT GCTCAATGGT GCTACAAGCT TACGCCTGTC CTCGCCTCCT CGTGTTTGTC
AACCTGTCAG CCTGAGGGTG TACAGTAGTA GAAACTAGCA AGCAAACATG GTTGACTCAG GTTCTAATGC TTTGTCTTAG
CCCAACAACA ATCAATCCAT CTATCCTTAG CTAAAAGTAT GTGGTAAAAC TTGATTATAT TGGACCAAAT AACCATCAGG
CCCAACTTTA CTGAAATGAA AATAAACAAG TCATTTATAT ACCTCACAAG TAAAAAAATT TTAAATGCAA TTCTGAGCAT
TAAAATCACA TTTATAACTA ATTCGTTATA CAAGTACTTC GTTTCAATTA AAGTATAACA TATTCAAATA TATCTTCACA
AAAAAATATC GTAGTTTAAT TTGAGGTTTT TTGGAATAAT ATGATTTGCT TCACAATAAA ACGAAGCTGA AAATTCATCA
GAAAGTTTTT ATCATAATCT ATATTGAAAA TAACACATAA ATAGTATAAC ATGGGCTATA AAGTAAACGC GCGAATCGGC
GTGTTAATTT CCTAGTGTAT TCTATAATCT GTACATTTTT CTGGTGCCTA TAATTGCTTT GTGGGTCAAC CATAGTGCAT
TATCCATGTG AGTGTTATGA TGTAAGCATG GATGGAGTTG ACCTATTATT TCATACGTTC GTATTTACTT TATATTATTT
CAATAGTTAT GCCTAATAAA GTTAGCATAT CTTTGAGACA TTAAGGAAAC TTGTTGAAAT TAACAGCATG CCACGAAGCA
GGATTCACCT GTGTTTGGTT TATGCCCTCA ATTGTTGTTC TCTAGACCTT TTATACTATT ATTATATGAA TACTTTTGTT
GGTGGTGATG GTCTGCCTGC CAACCTACCC TCAGCCACCA CTTTATTGCT GGCAATGAAA TAGACATGAT CAGGGTTTCA
GATCATACCA CTATAGCCAT TAAATGATTG AGGAGTTCTG ATAGTTATTC CCTGACCAGT TGTGGCGGTT TGATCCCTGC
CAAGAATCCT TAATGTTTGA TCCTTATCTA ATGATGGAGC TTTTACAGGC TTACCCGGTA CAAGAACTTC AAGGAAGGAC
ACAAGAGGAT TCTTGTGGCT ACTGATTTAG TTGGCAGGGG AATTGATATT GAACGTGTCA ACATTGTCAT AAACTATGAC
ATGCCCGATT CTGCTGATTC GTATCTACAC AGGGTAATTT TAACATCACT TCACTGCTTC TCTTTAAGTT CTTTCTCTTG
CTGACATTCT ATCCTCCAGG TTGGAAGGGC TGGGCGTTTT GGAACCAAAG GACTTGCAAT AACATTTGTT TCCTCTGCCT
CTGACTCTGA TGTTCTTAAT CAAGTTAGTA CAACTGATCA TTTTAATTTT GTTGCTTAAC TGGTGTGATG ACAAAGCCTC
ACTGTAATTT CTCATGCATG ATGTTTTAAG GTGCAAGAAA GATTCGAGGT TGACATAAAG GAGCTTCCTG AGCAGATTGA
TACTTCGACA TATAGTAAGT GTTGTTTACC TTGTTATTCC AGATTAATTT GTAATACCAT ATCATATGAT TTGTTCAAAG
AACTGATTTG TTGTATTTTG ATTTGTATTT TCCAGTGCCT TCTTAAAGAT CCGGGTGGAT TGCTTAAAGC TTACATTCGA
ACGGAAACGA GAGTATCTCC TTGAGATACG GCATATTAAG AATCTATCGG ATAACTAAAA ACTTAGTGTG AGAAATGCTG
CCCTATCTAT ACTTAGACAG CAGTTTAGAT CTGCTGCTAA GTGCTGAATG CCCCGTAATA ATACTTGAAA TGATGTATCT
GGGCAATTGG GCATGTACGT ATTTGAATTG CAGTCGTTCA TTGTAATTCC GAGAATTTTA TTAGGATTTG TTTGTGTTAA
TTTTGCTACT CCGCAGATGC TAACGTGGGT TAGTTTATAG TACTTTGTTT ATGGTACTTT TGAGGATTTC 

Locus: Os01g0549700

Loading...

Locus: Os01g0549700

Loading...