Os01t0555100-01

Locus

Os01g0555100

Description

Similar to TATA-binding protein associated factor 2N (RNA-binding protein 56) (TAFII68) (TAF(II)68).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

SRZ3

Oryzabase Gene Name Synonym(s)

stress repressive zinc finger protein 3

Transcript Evidence

AK111255 (DDBJ, Best hit)

Protein Evidence

A2WRB0 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Cellular Component: intracellular (GO:0005622)

Molecular Function: zinc ion binding (GO:0008270)

Functional domain (InterPro)

Zinc finger, RanBP2-type (IPR001876)

Full-length cDNA

002-180-E06 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0555100-01)

RiceXPro (AK111255)

Others

Oryzabase (15132)

KEGG (Os01t0555100-01)

Transcript

931 bp

>Os01t0555100-01 Similar to TATA-binding protein associated factor 2N (RNA-binding protein 56) (TAFII68) (TAF(II)68).
AAGCCTCCATCCATCCATCCATTCATCAGAGCTCAAGCTCAAGCAAGCAAGCTTGCTAGC
TAGCTGCTGAGCAGCATTCCAGTCTGCTCCAGCTAGCTCAGCTCTCTCTGCTCTGCTCTT
TGCTCGATAACGACCATCATCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTG
TACATTCTATTTGCTCGATAGATAGATAGATAGATAGATAGGTAGATAGAGATGGAGACG
AAGGCGGCGGCGATGGCGATGAGGAAGCCGGGGGACTGGAGCTGCAGGTCGTGCCAGTAC
GTGAACTTCTGCAAGAGGGAGGCGTGCCAGCGGTGCGGGGAGGCGAAGCTCGGGGTGGAG
CGGACGGACTACGCCGCCATGGGCGGCGGGTGGGAGGTGAAGCCCGGCGACTGGTGCTGC
CGCTGCTGCGCCGTCAACAACTACGCCAGCCGCGGCAGCTGCTTCAAGTGCGGCGCCGCC
AAGAACGACTCCGCCGCCGCCGTCGCCCAGGGCTGGGGCTTCTCCGTCGCCTCCCAGGCC
GGCTGGAAGAACGGCGACTGGATCTGCCCCAGAATGGAATGCAACGTGCAGAACTACGCT
AACAGAACCGAGTGCTTCCGGTGCAATTTCCCCAGATACTACGTTGATTGATCTGACATA
TATGATATATGCCTTGCACTGAGAAGAAATGAAAGGGAAATAAAATTTACGAGATCGAAG
ATCGACGGACAAGATTGATCGGCCACCGGTCATGCCCTTCAGGGTTTTCTTTTTTCTATT
TTTTTTTAGAATAACCCTCGATAACCTGAGGGTTTTTTTTCATTTGTAAGAGCGGTAACG
GTACTAAAAAAACACAAAAACGGCACAAAATTGTGGCTGATGACTGATCAGTCTTCCTCT
TTTTTTTCCCAATAAAAGGCAGATAATTAAG

CDS

420 bp

>Os01t0555100-01 Similar to TATA-binding protein associated factor 2N (RNA-binding protein 56) (TAFII68) (TAF(II)68).
ATGGAGACGAAGGCGGCGGCGATGGCGATGAGGAAGCCGGGGGACTGGAGCTGCAGGTCG
TGCCAGTACGTGAACTTCTGCAAGAGGGAGGCGTGCCAGCGGTGCGGGGAGGCGAAGCTC
GGGGTGGAGCGGACGGACTACGCCGCCATGGGCGGCGGGTGGGAGGTGAAGCCCGGCGAC
TGGTGCTGCCGCTGCTGCGCCGTCAACAACTACGCCAGCCGCGGCAGCTGCTTCAAGTGC
GGCGCCGCCAAGAACGACTCCGCCGCCGCCGTCGCCCAGGGCTGGGGCTTCTCCGTCGCC
TCCCAGGCCGGCTGGAAGAACGGCGACTGGATCTGCCCCAGAATGGAATGCAACGTGCAG
AACTACGCTAACAGAACCGAGTGCTTCCGGTGCAATTTCCCCAGATACTACGTTGATTGA

Protein

140 aa

>Os01t0555100-01 Similar to TATA-binding protein associated factor 2N (RNA-binding protein 56) (TAFII68) (TAF(II)68).
METKAAAMAMRKPGDWSCRSCQYVNFCKREACQRCGEAKLGVERTDYAAMGGGWEVKPGD
WCCRCCAVNNYASRGSCFKCGAAKNDSAAAVAQGWGFSVASQAGWKNGDWICPRMECNVQ
NYANRTECFRCNFPRYYVD*

5'UTR

chr01:20935789..20936019 (+ strand) : 231 bp

CDS

chr01:20936020..20936360 (+ strand) : 341 bp

chr01:20936966..20937036 (+ strand) : 71 bp

chr01:20937149..20937156 (+ strand) : 8 bp

3'UTR

chr01:20937157..20937436 (+ strand) : 280 bp

FASTA

>Os01t0555100-01 class=Sequence position=chr01:20935789..20937436 (+ strand)
AAGCCTCCAT CCATCCATCC ATTCATCAGA GCTCAAGCTC AAGCAAGCAA GCTTGCTAGC TAGCTGCTGA GCAGCATTCC
AGTCTGCTCC AGCTAGCTCA GCTCTCTCTG CTCTGCTCTT TGCTCGATAA CGACCATCAT CTTCTTCTTC TTCTTCTTCT
TCTTCTTCTT CTTCTTCTTG TACATTCTAT TTGCTCGATA GATAGATAGA TAGATAGATA GGTAGATAGA GATGGAGACG
AAGGCGGCGG CGATGGCGAT GAGGAAGCCG GGGGACTGGA GCTGCAGGTC GTGCCAGTAC GTGAACTTCT GCAAGAGGGA
GGCGTGCCAG CGGTGCGGGG AGGCGAAGCT CGGGGTGGAG CGGACGGACT ACGCCGCCAT GGGCGGCGGG TGGGAGGTGA
AGCCCGGCGA CTGGTGCTGC CGCTGCTGCG CCGTCAACAA CTACGCCAGC CGCGGCAGCT GCTTCAAGTG CGGCGCCGCC
AAGAACGACT CCGCCGCCGC CGTCGCCCAG GGCTGGGGCT TCTCCGTCGC CTCCCAGGCC GGCTGGAAGA ACGGCGACTG
GATCTGCCCC AGGTAATTTC ATACTTCATT AGTTGTTCCT AGCTCGTTCA AGTCTAAGTC TTGTCCTAAC GAAACAAAAT
ACGTCTTATA TTTCTTTTTT ATTTTAAGAG GCGGAGGTGG CTGCTTGGGA ATGCAGCATG CTCTGCCTCT GGCTAATCAC
ATTAGCTGAT TAATTTAATT AGATTGCACG GAGATGCATG CATAAGTGTG CAAATTGTTC TTTTGCCACG ATCGAGCATG
TCTCTGTGAA AATAGTATTA GTTGTTTTTT TGAACATTAA TAGTATTAGT TATATGTGTT TAAAAAGGAA ACGCTAAACT
AAAGCATGCA TGTGTCTAGT CCAAAGATTC TATGCCCAAC AGAATCCGGA GCTGCATGCC AACTGGAATA TTACCTCTTG
ACGTGTCAGT TCTGCATTCC TTGTTTTAGT TACTACCACT GCTGATCAAG ATGTTTAATT ACGACACCTC AAGCTTTGTT
TAAAAAAAAC TGATCGACCA GCATTGATAA TAGTTCTGAA TGTGAATGTT ATCATCTGTT CTGAAGAAGT ATATATATAT
ATATATATAT GGAATGTTAG TGCTGATGCA TATTTACATG TTTTGGTGAT TTTGCAGAAT GGAATGCAAC GTGCAGAACT
ACGCTAACAG AACCGAGTGC TTCCGGTGCA ATTTCCCCAG ATACTACGGT AAGCTACCCA CATGATGGCA CATTTGCAAT
TTGACAGTGA CAAACTGCTG CTAAATATAT GATCTCATCT GATTCAGTTT TCTCTTCTCT TCTTTCTCTA CTCTTTTCAG
TTGATTGATC TGACATATAT GATATATGCC TTGCACTGAG AAGAAATGAA AGGGAAATAA AATTTACGAG ATCGAAGATC
GACGGACAAG ATTGATCGGC CACCGGTCAT GCCCTTCAGG GTTTTCTTTT TTCTATTTTT TTTTAGAATA ACCCTCGATA
ACCTGAGGGT TTTTTTTCAT TTGTAAGAGC GGTAACGGTA CTAAAAAAAC ACAAAAACGG CACAAAATTG TGGCTGATGA
CTGATCAGTC TTCCTCTTTT TTTTCCCAAT AAAAGGCAGA TAATTAAG

Locus: Os01g0555100

Loading...

Locus: Os01g0555100

Loading...