Os01t0559500-01

Locus

Os01g0559500

Description

Pentatricopeptide repeat (PPR) protein, Splicing of chloroplast mRNA, Chloroplast development, Abiotic stress response

RAP-DB Gene Symbol Synonym(s)

WSL

RAP-DB Gene Name Synonym(s)

white stripe leaf

CGSNL Gene Symbol

WSL

CGSNL Gene Name

WHITE STRIPE LEAF

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

white stripe leaf

Transcript Evidence

AK288159

Protein Evidence

Q5JKQ7

Literature

PMID: 24821718

Note

Manual Curation

September 26, 2018

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

Tetratricopeptide-like helical domain superfamily (IPR011990)

Pentatricopeptide repeat (IPR002885)

Experimentally confirmed subcellular location

chloroplast (GO:0009507)

Full-length cDNA

J090001G18 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0559500-01)

Others

Oryzabase (19637)

KEGG (Os01t0559500-01)

Transcript

2171 bp

>Os01t0559500-01 Pentatricopeptide repeat (PPR) protein, Splicing of chloroplast mRNA, Chloroplast development, Abiotic stress response
CGCGAACACAGCAGCGCCCCGCCGGCGGCGAGATGGAGGCCGCCGCGTCGCTGCCGCTCC
CCGCCTCCCGCTTCCTCTCCCCTCCTCCTCATCCAACGCCAGCGGCGGCGGCGGCGGCGG
CGTGCTGCTCCCGACGGAACATCTCCTGCGCCCGCGCCGCCCCCCGGGCGCTGGAAGCCC
CGCAGGCCTCGAGGCCGCCACCGCGGCCGTCGCCTCGGCGCAGCGCCGTCGCGGAGGTCA
AGGCCGCCCCCGACCCCGTCGCCGCACTCACCAGGTTCGAGGATGTGCTGCAGACACAGG
ACTGCAACATAATCCTGCGCCACTACGGTGAAACCAGGCGCTGGGATGAGCTATCTAAGG
TCTTCGGGTGGATGCAGGAGCACGACATGCTCAACATTGCGTCTTACAGCAGTTACTTCA
AGTACCTTGGGTTGAGCCGCAACCCTGCCCGAGCGCTGCAAGTGTACGGTGCTATCCGAG
AAAACCCGACAAGGATCCATGTCTCCGTTTGTAACTCGGTCCTCGGGTGCTTGGTGAAGA
ACGGGAGGTTCGATAGCAGCTTCAAGCTTTATGATGAGATGATACGAGAAGGTCTATCAC
CCGATCTGTTCACCTACAGTACCCTTCTGTCAGGGTGCATGAAGTTGAAGCAGGGTTACA
CTAAGGCCATGGAATTAGTTAATGAGCTGAATTCCCGTGGTTTTCAGATGGATAGTGTAA
TATATGGCACTCTCCTGGCTATATGCGCGTCACATAACTGCTGCGAGAAGGCTGAGGAAT
ATTTTCAGAAAATGAAGGACGAAGGACACAAGCCTAATCTATTCCATTATAGCTCTCTGT
TGAATGCATATTCAGAAAATGCTAATTATGAAAAGGCTGATCTGTTGATGAAAGATTTGA
GGTCCTCAGGGTTAACACCGAACAAGGTTATACTCACCACTTTGTTAAAGGTGTATTCTA
AAGGTGGTCTCTTTGAGAAGGCAAGGGAACTGCTAACTGAACTGGAAGCTTCAGGCTTCG
CACAGGATGAGATGCCTTACTGCATATTGATTGATGGCCTTGTCAAAGAACGGAAGATAT
GGGAAGCCATGATTCTATTTAATGATATGAAAGAAAAAGGTGTCAAATCTGATGGCTATG
CATTCAGTATCATGATATCAGCATTACATCGAGGTGGCTATCGTGAAGAGTCAAAACAAC
TTGCAAAAGAATTTGAGGCCAAGAATGCAACATATGATCTGGTTATGCTTAATACATCAC
TTCGTGCTTACTGCAGCACCAATGATATGGAAAGTGTAATGATCATGCTTAGGAAAATGG
ATGAATCGAACATATCGCCTGATGCTATCACATTTAATACCTTAATAAGGTACTTCTGCA
TGGCAAAGGTCTATCACCTAGCATACAAGACAATTCAAGATATGCATACAAAGGGCCATC
AATTGAATGAGGAGCTTTGTTCTGAGATAATGATGCAGCTAGGAGAAGCGGGTTTTCCTT
CTGAAGCATTTTCTGTGTATAATATGTTGAGATATGGAAAGAGAACAGTGTGTAAATCTC
TTCATGAGAAGGTTTTATGTATCTTAGTTCCAGCTGGACTTCTCAAGGATGCATACGTAG
TTGTTAAGGACAATTCCGAGTTCATATCTCGACGCTCGCTGGGGAATTTTGCTAGATCTT
TCATGGCATCAGGCAACATAAATTTGATTAACGATGTTATGAAAGCAGTACACCGTTCAG
GATGGCGTATTAGCCAGGATATCTTTGGGAAAGCAATTCAGCGATACATTCAGAAACCTG
ATAAGAAGCAGCTACTGCTTTGCCTCTTGGACTGGATGACTGGTCAAGGCTATTCTGTGG
ACTCATCATCAAGGAACTTGCTTTTGAGAAATGCCCAACTCTTTGGCCAAAAGCAACTTA
TAGCTGAAATCCTTTCCAAGCAGCAGGGAGCATCAAGGATCACAAGTCAAAGGCACCAAA
AATAGTTGATAAGGTAGAATTCAATATATGTAAATTGTTCAGATTCATCCAAGAATATTC
TTTAGTAAACCATTGTTGATGATCAGTGTTAACATGTTCGTAGGGATCGGTTAGATCATC
AGGTAACAAGTTATTCACCCTCATCCTCATGTGTCCCAGGATCCAATCAAGATTCATCAG
AATTACAGATC

CDS

1953 bp

>Os01t0559500-01 Pentatricopeptide repeat (PPR) protein, Splicing of chloroplast mRNA, Chloroplast development, Abiotic stress response
ATGGAGGCCGCCGCGTCGCTGCCGCTCCCCGCCTCCCGCTTCCTCTCCCCTCCTCCTCAT
CCAACGCCAGCGGCGGCGGCGGCGGCGGCGTGCTGCTCCCGACGGAACATCTCCTGCGCC
CGCGCCGCCCCCCGGGCGCTGGAAGCCCCGCAGGCCTCGAGGCCGCCACCGCGGCCGTCG
CCTCGGCGCAGCGCCGTCGCGGAGGTCAAGGCCGCCCCCGACCCCGTCGCCGCACTCACC
AGGTTCGAGGATGTGCTGCAGACACAGGACTGCAACATAATCCTGCGCCACTACGGTGAA
ACCAGGCGCTGGGATGAGCTATCTAAGGTCTTCGGGTGGATGCAGGAGCACGACATGCTC
AACATTGCGTCTTACAGCAGTTACTTCAAGTACCTTGGGTTGAGCCGCAACCCTGCCCGA
GCGCTGCAAGTGTACGGTGCTATCCGAGAAAACCCGACAAGGATCCATGTCTCCGTTTGT
AACTCGGTCCTCGGGTGCTTGGTGAAGAACGGGAGGTTCGATAGCAGCTTCAAGCTTTAT
GATGAGATGATACGAGAAGGTCTATCACCCGATCTGTTCACCTACAGTACCCTTCTGTCA
GGGTGCATGAAGTTGAAGCAGGGTTACACTAAGGCCATGGAATTAGTTAATGAGCTGAAT
TCCCGTGGTTTTCAGATGGATAGTGTAATATATGGCACTCTCCTGGCTATATGCGCGTCA
CATAACTGCTGCGAGAAGGCTGAGGAATATTTTCAGAAAATGAAGGACGAAGGACACAAG
CCTAATCTATTCCATTATAGCTCTCTGTTGAATGCATATTCAGAAAATGCTAATTATGAA
AAGGCTGATCTGTTGATGAAAGATTTGAGGTCCTCAGGGTTAACACCGAACAAGGTTATA
CTCACCACTTTGTTAAAGGTGTATTCTAAAGGTGGTCTCTTTGAGAAGGCAAGGGAACTG
CTAACTGAACTGGAAGCTTCAGGCTTCGCACAGGATGAGATGCCTTACTGCATATTGATT
GATGGCCTTGTCAAAGAACGGAAGATATGGGAAGCCATGATTCTATTTAATGATATGAAA
GAAAAAGGTGTCAAATCTGATGGCTATGCATTCAGTATCATGATATCAGCATTACATCGA
GGTGGCTATCGTGAAGAGTCAAAACAACTTGCAAAAGAATTTGAGGCCAAGAATGCAACA
TATGATCTGGTTATGCTTAATACATCACTTCGTGCTTACTGCAGCACCAATGATATGGAA
AGTGTAATGATCATGCTTAGGAAAATGGATGAATCGAACATATCGCCTGATGCTATCACA
TTTAATACCTTAATAAGGTACTTCTGCATGGCAAAGGTCTATCACCTAGCATACAAGACA
ATTCAAGATATGCATACAAAGGGCCATCAATTGAATGAGGAGCTTTGTTCTGAGATAATG
ATGCAGCTAGGAGAAGCGGGTTTTCCTTCTGAAGCATTTTCTGTGTATAATATGTTGAGA
TATGGAAAGAGAACAGTGTGTAAATCTCTTCATGAGAAGGTTTTATGTATCTTAGTTCCA
GCTGGACTTCTCAAGGATGCATACGTAGTTGTTAAGGACAATTCCGAGTTCATATCTCGA
CGCTCGCTGGGGAATTTTGCTAGATCTTTCATGGCATCAGGCAACATAAATTTGATTAAC
GATGTTATGAAAGCAGTACACCGTTCAGGATGGCGTATTAGCCAGGATATCTTTGGGAAA
GCAATTCAGCGATACATTCAGAAACCTGATAAGAAGCAGCTACTGCTTTGCCTCTTGGAC
TGGATGACTGGTCAAGGCTATTCTGTGGACTCATCATCAAGGAACTTGCTTTTGAGAAAT
GCCCAACTCTTTGGCCAAAAGCAACTTATAGCTGAAATCCTTTCCAAGCAGCAGGGAGCA
TCAAGGATCACAAGTCAAAGGCACCAAAAATAG

Protein

651 aa

>Os01t0559500-01 Pentatricopeptide repeat (PPR) protein, Splicing of chloroplast mRNA, Chloroplast development, Abiotic stress response
MEAAASLPLPASRFLSPPPHPTPAAAAAAACCSRRNISCARAAPRALEAPQASRPPPRPS
PRRSAVAEVKAAPDPVAALTRFEDVLQTQDCNIILRHYGETRRWDELSKVFGWMQEHDML
NIASYSSYFKYLGLSRNPARALQVYGAIRENPTRIHVSVCNSVLGCLVKNGRFDSSFKLY
DEMIREGLSPDLFTYSTLLSGCMKLKQGYTKAMELVNELNSRGFQMDSVIYGTLLAICAS
HNCCEKAEEYFQKMKDEGHKPNLFHYSSLLNAYSENANYEKADLLMKDLRSSGLTPNKVI
LTTLLKVYSKGGLFEKARELLTELEASGFAQDEMPYCILIDGLVKERKIWEAMILFNDMK
EKGVKSDGYAFSIMISALHRGGYREESKQLAKEFEAKNATYDLVMLNTSLRAYCSTNDME
SVMIMLRKMDESNISPDAITFNTLIRYFCMAKVYHLAYKTIQDMHTKGHQLNEELCSEIM
MQLGEAGFPSEAFSVYNMLRYGKRTVCKSLHEKVLCILVPAGLLKDAYVVVKDNSEFISR
RSLGNFARSFMASGNINLINDVMKAVHRSGWRISQDIFGKAIQRYIQKPDKKQLLLCLLD
WMTGQGYSVDSSSRNLLLRNAQLFGQKQLIAEILSKQQGASRITSQRHQK*

5'UTR

chr01:21195400..21195431 (+ strand) : 32 bp

CDS

chr01:21195432..21195673 (+ strand) : 242 bp

chr01:21195878..21195962 (+ strand) : 85 bp

chr01:21196049..21196312 (+ strand) : 264 bp

chr01:21196408..21196710 (+ strand) : 303 bp

chr01:21197585..21197689 (+ strand) : 105 bp

chr01:21197806..21197905 (+ strand) : 100 bp

chr01:21199504..21199823 (+ strand) : 320 bp

chr01:21200073..21200249 (+ strand) : 177 bp

chr01:21200322..21200450 (+ strand) : 129 bp

chr01:21200741..21200968 (+ strand) : 228 bp

3'UTR

chr01:21200969..21201154 (+ strand) : 186 bp

FASTA

>Os01t0559500-01 class=Sequence position=chr01:21195400..21201154 (+ strand)
CGCGAACACA GCAGCGCCCC GCCGGCGGCG AGATGGAGGC CGCCGCGTCG CTGCCGCTCC CCGCCTCCCG CTTCCTCTCC
CCTCCTCCTC ATCCAACGCC AGCGGCGGCG GCGGCGGCGG CGTGCTGCTC CCGACGGAAC ATCTCCTGCG CCCGCGCCGC
CCCCCGGGCG CTGGAAGCCC CGCAGGCCTC GAGGCCGCCA CCGCGGCCGT CGCCTCGGCG CAGCGCCGTC GCGGAGGTCA
AGGCCGCCCC CGACCCCGTC GCCGCACTCA CCAGGTGCGC CGCCCACTAT ATGCTTCTCC GTAGCTCTAT CGGAGCATTC
TACATTTTCG TCTTCGTAGT AGTAATTCGC GCGAATTGGA TATATCGAAA CGTGGATTCA GAGGGAGGAA CAAGAGAAAC
TGAGGTGTTG GGGTAGGATT ATTGTTGCTC GATTTGGAGT TGTTAGTTCT GCGAATTCTG ACCTTTGATG CTGTACAGGT
TCGAGGATGT GCTGCAGACA CAGGACTGCA ACATAATCCT GCGCCACTAC GGTGAAACCA GGCGCTGGGA TGAGCTATCT
AAGGTAGTCT TCAGTGGTTG TCAAGTTCAA TCAGGCGAGT GGAGATTGAT GGGACTAGTG AGGCATGAGT AGTCTGAACT
TTGTTTCAGG TCTTCGGGTG GATGCAGGAG CACGACATGC TCAACATTGC GTCTTACAGC AGTTACTTCA AGTACCTTGG
GTTGAGCCGC AACCCTGCCC GAGCGCTGCA AGTGTACGGT GCTATCCGAG AAAACCCGAC AAGGATCCAT GTCTCCGTTT
GTAACTCGGT CCTCGGGTGC TTGGTGAAGA ACGGGAGGTT CGATAGCAGC TTCAAGCTTT ATGATGAGAT GATACGAGAA
GGTCTATCAC CCGATCTGTT CACCTACAGT ACCGTATGGG ACTATGACCT TTTCTTTTTC TCTGATTAGC ATTTAGTTTG
GTACTTTGGT TGGTGTAGCA TTTCAATTGT TTCTCTTGTC ACTTCTAGCT TCTGTCAGGG TGCATGAAGT TGAAGCAGGG
TTACACTAAG GCCATGGAAT TAGTTAATGA GCTGAATTCC CGTGGTTTTC AGATGGATAG TGTAATATAT GGCACTCTCC
TGGCTATATG CGCGTCACAT AACTGCTGCG AGAAGGCTGA GGAATATTTT CAGAAAATGA AGGACGAAGG ACACAAGCCT
AATCTATTCC ATTATAGCTC TCTGTTGAAT GCATATTCAG AAAATGCTAA TTATGAAAAG GCTGATCTGT TGATGAAAGA
TTTGAGGTCC TCAGGGTTAA CACCGAACAA GGTTTGCTTC TTATTCTTGT TATTtacttc ctctgtttca cattataaga
cattttgttt tctaatagat ttatgcatgg attcatatat gtacttcata tgtgtctaaa tgcatatgga tgttagtgaa
tctagacgaa gaatggagag gccaaaacgt cttataatgt agaacagagg gagtaTTAAT TAACTCTGTT GCTGAGTTTT
ATGATTTGCA GGAGACCCCA GTCTTGTTAT TTCACTTTTT GGTTATGGCA GTAGAATTGA TTTCTCATTA GATATAATGC
ATACCTACAC CACAGGTTGG ATAGTTTGTT GCTATGGATG ACTTGAAATG CTAGATAGCA CATACAGGTT GTAGCTTGCA
TAGTATATGG TGTTGGTGTT TTGGTGCAAA AGTTGGTTTC TCCAGCTGCA TAATTTATTT GGTACTAGTG CGGTAGTGCC
TTCTAACTTC ACCGCGTAAT GTCTGTGAAT GATGCCTGTC GATGTATATG AAAAACAAAT ACTGCCCTAT GATAGCCATC
AATAAGCACT AAACAAATGC CATGGTTGGA AAGAACATTC TCACACTAAG TAGAGAAAGC TTGCACATCA AATTCCATCA
AAGTTGTGGT ACCATGTTTA CTTGCCGCTT GGCACGTGAT GTATTGAATA GAGCTTTCGA TAGCTTGGGT TAAGGTGGAA
TGTAGTGCTC CAGGATAAAT TTTTTTTTTA AAAAGCCTCT TAAGTCTCCA CATATCAACT ATAACTACAT GTTATCTTGA
TTGGTTGTTT CTTTACTGAA CTTGCATATA TTGCTCTTTG GTTGTTCACC GAAAATGTTC TGCTACTGTT GCCATTCTAA
TTTGTAAATT AAATTAAATT TGCAGGTTAT ACTCACCACT TTGTTAAAGG TGTATTCTAA AGGTGGTCTC TTTGAGAAGG
CAAGGGAACT GCTAACTGAA CTGGAAGCTT CAGGCTTCGC ACAGGATGAG GTAAAATATT TGGTCTCACA CAAAACAGCT
GCTTCATATG CATGTATGAA TGGCTCCTTT AATTGAACTT TATTCTGTCT TGTCATAATC CCTTAATCCT TTAATACTAT
GCCCAGATGC CTTACTGCAT ATTGATTGAT GGCCTTGTCA AAGAACGGAA GATATGGGAA GCCATGATTC TATTTAATGA
TATGAAAGAA AAAGGTGTCA AATCTGGTAA GGTATCTAAC AATGTAACAA ATTGATGTGC CTCTATTGAT ACTATTCTGA
TTTTTTGTTG TAATTGGGAA AGTTCATGGA GCTAATTCCA CGATTTTCCA TTGACATAGC ACATCTTCCG TTGATGCTAC
TGACAAACCA GCTTCATTCC ATCCATGCCA TTGCCATTAG GTTGCAAAAT GACCAATTTT ACCTTGCTCA CCATTCCGAT
TTTTGGAATA TAAATTACTG TAATTAAAAT GAATACCTGA AAACTTGAAA ATTAAAATTA CCAAACCTTA TAATTCGAAA
TTTAAAATGT TAGAATACAC AAATATAAAA GTTTATTTTC AAAATTTTTA ATATTTGTTC AGGTTCAACC TGATTTTAAA
ATTTGGATTG TAGGATTTAA AATTTGAGTT CTATTTTAAA AAGATTGGAT TGCAATAAAA TTTGAATTCT GAAAGGGAAT
ATTAGTGTTT CTGCTGCTAC TAGCATGATT TTACAATGTT GAGCAGGGCA AGTTGATCTT TTCCACCAAT GTCACTCTAA
TGGGAGGAAC ACGGAGGCAA TGGTGTGGAA GGAATGAAGT TGGCTTGTCA ATGATTGGAA TAGAAATGTG TTTTGTCGAT
GGAAAATCAT GGAATTGGCT TCCTATTGAT GGCATATAAT GATGTTCAAT ATCTGGTTCC TAACAACACA TTATCTGTTT
ACTGTATGCA AATTAGTGTG CAAAATCTAT TGTGTGCTTT GTAACAGAAG ATTTATTTTA TGGTTACATT TATTTCTAAT
TTTGTTATGT AGCCTTTTAG TAAACAAAGA ATCTTTTGTA GCATGCTCAT TCCAGTCTAA AAAATGATTT GTGTTAGGCT
TTTCAAAGTC AACATTACAC AACTTTGAGC ACCTAGCTCT TTAGCATAAA TTAAAAAAGA GTAAATATCA ATTAAAAAAg
agtaaatttc acaaaactac atgttttgtg gttcaagttg cagaaaacca cacacatttt gacacttggc acttaagtac
atatattttg gttgtgtagt ttcacaaaac cacactatcg ataaatggat tcacctgcga gatgacgtgg ctgtttcacc
taggacgagg acatgacatc ctattaccag ccatcgcacg aaattaatag tatgccacgt cgatggaaca accatgtcat
ctcaccggtg aatccattca tcgatagtgt ggttttgtga aactaaacta ccaaaatata tgtacttaag tgctaagtgt
caaaatgtgt gtggttttct gcaatttgaa ccataaaaca tgtagttttg tgaaatttac tcATTAAAAA AAGAAGTTAC
ATAAGTGAAA TATAATGAAA TCTCTAGTTT TGAAAAACTT GATTATGCTA TTTTCATATA CCTAACATTT ATTTTTTTAA
TGATTTTTAT GCTCAAAATT AACTTGTGTT GACTGGCATG ATAAAACAAC CTGTTTATGA AACTGGTGGG AGTAGTATGT
TGATTTTTTT TCCCTGGAGT ATTTTCTAGT GCTGCTGCCT GCTATTACCC AGAATTTGTG TCTTGTTGTC CTTGCCTAAG
GAGCTTATCT TCTTATTTCT GCAGATGGCT ATGCATTCAG TATCATGATA TCAGCATTAC ATCGAGGTGG CTATCGTGAA
GAGTCAAAAC AACTTGCAAA AGAATTTGAG GCCAAGAATG CAACATATGA TCTGGTTATG CTTAATACAT CACTTCGTGC
TTACTGCAGC ACCAATGATA TGGAAAGTGT AATGATCATG CTTAGGAAAA TGGATGAATC GAACATATCG CCTGATGCTA
TCACATTTAA TACCTTAATA AGGTACTTCT GCATGGCAAA GGTCTATCAC CTAGCATACA AGACAATTCA AGATATGCAT
ACAAAGGGCC ATCAATTGAA TGAGGTATGT TGCTTGTTGT GTATTTGACC GATTTAATAT ATCGCTGCTT AACTCTATGC
TAGATTAAAC CATGGTTACT ACATATTTAC ATCCTTGGTA ATTTCCGCTG ATTGGAATTT GGACTACCTA TTATTACATA
TGTGCAGAAT AGAGTGGGTG AGAGTTGCAC ATTTCCTTGC AACATGCTTT GCATCAACTT TCAGTAATAG ACAGTTTATA
TCAGTAACCA AAATTGCTAT ACATCTTCTC CAGGAGCTTT GTTCTGAGAT AATGATGCAG CTAGGAGAAG CGGGTTTTCC
TTCTGAAGCA TTTTCTGTGT ATAATATGTT GAGATATGGA AAGAGAACAG TGTGTAAATC TCTTCATGAG AAGGTTTTAT
GTATCTTAGT TCCAGCTGGA CTTCTCAAGG ATGCATACGT AGTTGTTAAG GTACTATACT TATGCAATTC AGTGTTGACA
TCTCTGTTGT TACCTTGTTC ACTATGAATG CTATTTGAAC AGGACAATTC CGAGTTCATA TCTCGACGCT CGCTGGGGAA
TTTTGCTAGA TCTTTCATGG CATCAGGCAA CATAAATTTG ATTAACGATG TTATGAAAGC AGTACACCGT TCAGGATGGC
GTATTAGCCA GGTGACTGTT CTTTGCTTGC ACTTTGTTAT AGTTTGGAGT TGAAGTTGAA ACCCCAGATT TCTGGATGTT
CAAACTGGTA ATTTTGTTTT TAGAGCTGAC TAGGACAGAG GGATGCAAAA AAAAAAGTGA TTGCCATAAG CTAGCTAAAA
GAGTTCATTT GCACACCACA TATTTTTAGT TCATGATATT TTCCTTTCTT TGTTCTTTGT CCTTTTCCAT TTTTTGCTGG
ATGGTGTGCT AACTTACGTA CTTACCCCTT CAAATGGTGG ACACAACCAT TACACACGCA GGATATCTTT GGGAAAGCAA
TTCAGCGATA CATTCAGAAA CCTGATAAGA AGCAGCTACT GCTTTGCCTC TTGGACTGGA TGACTGGTCA AGGCTATTCT
GTGGACTCAT CATCAAGGAA CTTGCTTTTG AGAAATGCCC AACTCTTTGG CCAAAAGCAA CTTATAGCTG AAATCCTTTC
CAAGCAGCAG GGAGCATCAA GGATCACAAG TCAAAGGCAC CAAAAATAGT TGATAAGGTA GAATTCAATA TATGTAAATT
GTTCAGATTC ATCCAAGAAT ATTCTTTAGT AAACCATTGT TGATGATCAG TGTTAACATG TTCGTAGGGA TCGGTTAGAT
CATCAGGTAA CAAGTTATTC ACCCTCATCC TCATGTGTCC CAGGATCCAA TCAAGATTCA TCAGAATTAC AGATC

Locus: Os01g0559500

Loading...

Locus: Os01g0559500

Loading...