Os01t0578500-01

Locus

Os01g0578500

Description

F-box protein, Indica-Japonica hybrid male sterility

RAP-DB Gene Symbol Synonym(s)

SAF, SaF, OsFbox019, OsFbox19, Os_F0070

RAP-DB Gene Name Synonym(s)

HYBRID STERILITY, Hybrid male sterility, F-box protein 19

CGSNL Gene Symbol

SAF

CGSNL Gene Name

HYBRID STERILITY

Oryzabase Gene Symbol Synonym(s)

SaF, OsFbox019, OsFbox19, Os_F0070

Oryzabase Gene Name Synonym(s)

Hybrid male sterility, F-box protein 19

Transcript Evidence

EU337974 (Genbank)

EU337975 (Genbank)

Protein Evidence

Q9AWX3 (UniProt)

B6RRX2 (UniProt)

Literature

PMID: 19033192

Note

Manual Curation

June 12, 2009

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

F-box domain, cyclin-like (IPR001810)

FBD (IPR006566)

Expression Databases

TENOR (Os01t0578500-00)

Others

Oryzabase (8207)

Transcript

1431 bp

>Os01t0578500-01 F-box protein, Indica-Japonica hybrid male sterility
ATGGAGGCGGTCATCGCGGAGTGccgccccaagcctctcttcaccaccgggcccttcctc
tccgccgtcggcggcggcggcggcggcgtcgaccgcatctccgggctccccgacgacctc
ctctttgtcatcctctccaagctccccgtcagggatgccgtggcgacgtccgccctctcc
ccccgctggaagagcctctggtccagcgtcccgctccgcctcgacgacgccggcctcctc
caccgccgcgacggcacgcgcctcggccgggaaggcgtcgccgccaccgtctccgccgtc
ctcgccgcccacccaggccccgtgcccgcggcctccgttgggtgctgcctctcCTCCGAC
GACCAGGGCTACCAGCTGGGAGGCTGGCTCCGAGCCCTCGCCGCCAAGGGCGTTCGGCAA
CTGTGCCTGATGGGCGCGCCATGGTCGCCGCGCGCTGCTCTCCCCTCCGCTGTGTTCTCC
TGCTCATCCCTGCGGCGCCTCTTCCTTGGTTCCGTGCAATGCAACTGGGACCTCATACCA
GACCATGCCTGCTTCCCTGAGCTACGAGAGATCCAGATATGCAACGCCCTAATGAAGAGC
CAGGATCTGTCCCTTGTTTTGGCTGTCTGCCCAGCGCTTGAGACAGTGGAGATTCTTGCG
AGCCGTAACAAAATCCCCACCGTGCGAATGAGTAGCCATACTATCCGCAATACTTTGCTA
TGGAAGTCGGTGGCCAAGGAAGTGAACGTTTTGGACACCCCTTGCCTCAGCAGGGTTGTT
TTGTGGCAGGATCTTCTGCTGCCCCACTCAAGATATAATTCTAAGGTCACAATCAGCCGT
GCCACCAAAATGCGCATTTCCGGTTACCTGGACACCGGCATCAACACTTTGGTGATCAAC
GAAACCACAGTTAAGGTAAACACAAATATAAGCTTCAAGACACTTATCCCCAGCGTGAAG
GTTTTGGGTCTCTCTGTTCATTTCGGAGTACGAAAGGAGGCTTTGATGTCCATCAGCTTC
CTTAGGTGTTTTCCAGAGGTTGAGACACTACATATAACTAGCAAAACGGACAAGGCTTCA
GAAGCCGAACAATTCAGTTTCTGGGGAAAGGTTGATCCTGTTGAGTGTGTGACCTCTCAT
CTCAAGAAGTTAGTGTTCCATGGGATGCCATGGTGTCCTGGAAACCTTGAGTTTCTCAAA
TTCATCGTGGAAGGGGCATACTTGCTAGAGAAGGTGTTGATTGTTCTTCCTAAAGGAACT
TACACTAGCATGCATAGCGTTATCACCAAACTCAAGTTAGCACCTTTGACCTCTGCAAGT
TGGGCTAGTCACATCTGTAAAATGGAGGTTGTCCAATCCAGTCAAGGAACTTTGAGCTAC
CAAAGGGCATCTGATCATTCCGTCGATGATCCTTTAGATTATTCCCTGTAG

CDS

1431 bp

>Os01t0578500-01 F-box protein, Indica-Japonica hybrid male sterility
ATGGAGGCGGTCATCGCGGAGTGccgccccaagcctctcttcaccaccgggcccttcctc
tccgccgtcggcggcggcggcggcggcgtcgaccgcatctccgggctccccgacgacctc
ctctttgtcatcctctccaagctccccgtcagggatgccgtggcgacgtccgccctctcc
ccccgctggaagagcctctggtccagcgtcccgctccgcctcgacgacgccggcctcctc
caccgccgcgacggcacgcgcctcggccgggaaggcgtcgccgccaccgtctccgccgtc
ctcgccgcccacccaggccccgtgcccgcggcctccgttgggtgctgcctctcCTCCGAC
GACCAGGGCTACCAGCTGGGAGGCTGGCTCCGAGCCCTCGCCGCCAAGGGCGTTCGGCAA
CTGTGCCTGATGGGCGCGCCATGGTCGCCGCGCGCTGCTCTCCCCTCCGCTGTGTTCTCC
TGCTCATCCCTGCGGCGCCTCTTCCTTGGTTCCGTGCAATGCAACTGGGACCTCATACCA
GACCATGCCTGCTTCCCTGAGCTACGAGAGATCCAGATATGCAACGCCCTAATGAAGAGC
CAGGATCTGTCCCTTGTTTTGGCTGTCTGCCCAGCGCTTGAGACAGTGGAGATTCTTGCG
AGCCGTAACAAAATCCCCACCGTGCGAATGAGTAGCCATACTATCCGCAATACTTTGCTA
TGGAAGTCGGTGGCCAAGGAAGTGAACGTTTTGGACACCCCTTGCCTCAGCAGGGTTGTT
TTGTGGCAGGATCTTCTGCTGCCCCACTCAAGATATAATTCTAAGGTCACAATCAGCCGT
GCCACCAAAATGCGCATTTCCGGTTACCTGGACACCGGCATCAACACTTTGGTGATCAAC
GAAACCACAGTTAAGGTAAACACAAATATAAGCTTCAAGACACTTATCCCCAGCGTGAAG
GTTTTGGGTCTCTCTGTTCATTTCGGAGTACGAAAGGAGGCTTTGATGTCCATCAGCTTC
CTTAGGTGTTTTCCAGAGGTTGAGACACTACATATAACTAGCAAAACGGACAAGGCTTCA
GAAGCCGAACAATTCAGTTTCTGGGGAAAGGTTGATCCTGTTGAGTGTGTGACCTCTCAT
CTCAAGAAGTTAGTGTTCCATGGGATGCCATGGTGTCCTGGAAACCTTGAGTTTCTCAAA
TTCATCGTGGAAGGGGCATACTTGCTAGAGAAGGTGTTGATTGTTCTTCCTAAAGGAACT
TACACTAGCATGCATAGCGTTATCACCAAACTCAAGTTAGCACCTTTGACCTCTGCAAGT
TGGGCTAGTCACATCTGTAAAATGGAGGTTGTCCAATCCAGTCAAGGAACTTTGAGCTAC
CAAAGGGCATCTGATCATTCCGTCGATGATCCTTTAGATTATTCCCTGTAG

Protein

477 aa

>Os01t0578500-01 F-box protein, Indica-Japonica hybrid male sterility
MEAVIAECRPKPLFTTGPFLSAVGGGGGGVDRISGLPDDLLFVILSKLPVRDAVATSALS
PRWKSLWSSVPLRLDDAGLLHRRDGTRLGREGVAATVSAVLAAHPGPVPAASVGCCLSSD
DQGYQLGGWLRALAAKGVRQLCLMGAPWSPRAALPSAVFSCSSLRRLFLGSVQCNWDLIP
DHACFPELREIQICNALMKSQDLSLVLAVCPALETVEILASRNKIPTVRMSSHTIRNTLL
WKSVAKEVNVLDTPCLSRVVLWQDLLLPHSRYNSKVTISRATKMRISGYLDTGINTLVIN
ETTVKVNTNISFKTLIPSVKVLGLSVHFGVRKEALMSISFLRCFPEVETLHITSKTDKAS
EAEQFSFWGKVDPVECVTSHLKKLVFHGMPWCPGNLEFLKFIVEGAYLLEKVLIVLPKGT
YTSMHSVITKLKLAPLTSASWASHICKMEVVQSSQGTLSYQRASDHSVDDPLDYSL*

CDS

chr01:22375575..22376489 (+ strand) : 915 bp

chr01:22376576..22376719 (+ strand) : 144 bp

chr01:22376936..22377307 (+ strand) : 372 bp

FASTA

>Os01t0578500-01 class=Sequence position=chr01:22375575..22377307 (+ strand)
ATGGAGGCGG TCATCGCGGA GTGccgcccc aagcctctct tcaccaccgg gcccttcctc tccgccgtcg gcggcggcgg
cggcggcgtc gaccgcatct ccgggctccc cgacgacctc ctctttgtca tcctctccaa gctccccgtc agggatgccg
tggcgacgtc cgccctctcc ccccgctgga agagcctctg gtccagcgtc ccgctccgcc tcgacgacgc cggcctcctc
caccgccgcg acggcacgcg cctcggccgg gaaggcgtcg ccgccaccgt ctccgccgtc ctcgccgccc acccaggccc
cgtgcccgcg gcctccgttg ggtgctgcct ctcCTCCGAC GACCAGGGCT ACCAGCTGGG AGGCTGGCTC CGAGCCCTCG
CCGCCAAGGG CGTTCGGCAA CTGTGCCTGA TGGGCGCGCC ATGGTCGCCG CGCGCTGCTC TCCCCTCCGC TGTGTTCTCC
TGCTCATCCC TGCGGCGCCT CTTCCTTGGT TCCGTGCAAT GCAACTGGGA CCTCATACCA GACCATGCCT GCTTCCCTGA
GCTACGAGAG ATCCAGATAT GCAACGCCCT AATGAAGAGC CAGGATCTGT CCCTTGTTTT GGCTGTCTGC CCAGCGCTTG
AGACAGTGGA GATTCTTGCG AGCCGTAACA AAATCCCCAC CGTGCGAATG AGTAGCCATA CTATCCGCAA TACTTTGCTA
TGGAAGTCGG TGGCCAAGGA AGTGAACGTT TTGGACACCC CTTGCCTCAG CAGGGTTGTT TTGTGGCAGG ATCTTCTGCT
GCCCCACTCA AGATATAATT CTAAGGTCAC AATCAGCCGT GCCACCAAAA TGCGCATTTC CGGTTACCTG GACACCGGCA
TCAACACTTT GGTGATCAAC GAAACCACAG TTAAGGTATT TGTCCCTTTG TTGGATATAT ATCTCTAATC ATATCGAATC
TGTGAAACTG TGTTAACGCG TTTTAATCGT TGAATTTGAA GGTAAACACA AATATAAGCT TCAAGACACT TATCCCCAGC
GTGAAGGTTT TGGGTCTCTC TGTTCATTTC GGAGTACGAA AGGAGGCTTT GATGTCCATC AGCTTCCTTA GGTGTTTTCC
AGAGGTTGAG ACACTACATA TAACTGTGAG ATTTCTTTCC TTCTTTCATT CCCGACATAT ATATACATAA ATGTGAGATT
GCGAGATAGC TGTCTTTCTT CTTTCATTCC TGACATATGC ATCATTTTAC ACACTCACTG CAGCCATTCT TTCATTCCCG
ACATATGCAT CATTTTACAC ACTCACTGCA GCCATATGTT CCTTTGATAG CTGGAGGTGA TCAATTTTTC TTCTTGTGCA
GAGCAAAACG GACAAGGCTT CAGAAGCCGA ACAATTCAGT TTCTGGGGAA AGGTTGATCC TGTTGAGTGT GTGACCTCTC
ATCTCAAGAA GTTAGTGTTC CATGGGATGC CATGGTGTCC TGGAAACCTT GAGTTTCTCA AATTCATCGT GGAAGGGGCA
TACTTGCTAG AGAAGGTGTT GATTGTTCTT CCTAAAGGAA CTTACACTAG CATGCATAGC GTTATCACCA AACTCAAGTT
AGCACCTTTG ACCTCTGCAA GTTGGGCTAG TCACATCTGT AAAATGGAGG TTGTCCAATC CAGTCAAGGA ACTTTGAGCT
ACCAAAGGGC ATCTGATCAT TCCGTCGATG ATCCTTTAGA TTATTCCCTG TAG

Locus: Os01g0578500

Loading...

Locus: Os01g0578500

Loading...