Os01t0579600-01

Locus

Os01g0579600

Description

Similar to Calcineurin B-like protein 9.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CBL9

CGSNL Gene Name

CALCINEURIN B-LIKE PROTEIN 9

Oryzabase Gene Symbol Synonym(s)

OsCBL9

Oryzabase Gene Name Synonym(s)

Calcineurin B-like protein 9

Transcript Evidence

AK111735 (DDBJ, Best hit)

Protein Evidence

Q3HRN8 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Molecular Function: calcium ion binding (GO:0005509)

Functional domain (InterPro)

EF-hand-like domain (IPR011992)

EF-HAND 2 (IPR018249)

Full-length cDNA

J023045O14 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0579600-01)

Others

Oryzabase (6106)

Transcript

1494 bp

>Os01t0579600-01 Similar to Calcineurin B-like protein 9.
GATGGGGAGAGGCGGGGTGAGAGAGAAGCGCACGGGTGATTGATCTTGCATCCATGGAGT
CGGGCTACGGCTTCCGCTTCTCCGACGACGACGTGGAGTCGGCGAGCTCGCTGACGGTGG
GGGAGCGGCTGTGCGCGGCGTTCCTGCCGTTCGTCGCCATTGCCGAGGCCGTCTTCTTCG
CGCTCACCGACTGCCTCGCCGACCTCCTCCCGCCGTCCGCCGCCGCCTCCCGCCACCGCC
GCTCCGCCGCTTCCTCCTACCTCGCCGCCGTCGCCAGGAAATGGAACCACCAGCAGCGTG
GCAGGGTCGGCATCGGCTGCACCTCCCTCACCCTCCGCCAGCTCGCCCGCCTCGCCGACG
AATCCAGATGCTTCTCCGTGAACGAGGTGGAGGCGCTGTTCGAGCTCTACAAGAAGATCA
GCTGCTCCATCATCGACGACGGACTCATCCACAAGGAAGAGCTCCAGCTGGCATTGTTTA
AGACTCCAAGCGGCCAGAATCTTTTTCTTGATAGGGTTTTTGATTTATTTGATGAAAAGA
AAAATGGTGTAATAGAGTTTGATGAGTTTATTCATGCTCTTAGCGTCTTCCATCCATTGG
CACCATTGGAAGACAAGATAAATTGTAAGTACACTTCTTTCAGACACTACCTTCTTAAAT
TCATGTATCGAGGTATATTTACAATAAGGCCTCCCTTTGGATTGTTTTAGTTGCATTTAG
GTTGTATGACTTGAGACAAACTGGGTTTATTGAGCGTGAGGAGGTTAGTTCATCAAGGCA
CTCTGTATTAATTTGCAACAAGTATGTTATTTGTGTTCTAGTACAAATCTGGTAGTGACG
GCATGGTCTGTTTTGCAGGTTATGCAAATGGTTATCGCTATTTTGTCGGAATCTGATATG
AAATTGTCAGAAGAACTTCTCGAGGCCATTATTGATAAGACATTTGAAGATGCTGATGCT
GATAGGGATGGAAAAATAAACCAACAAGAATGGAAGGAATTCGTATTGCGGCATCCTAAT
CTATTGAAGAACATGACACTGCCTTATCTAAGGGACATCACGACAGTTTTCCCTAGTTTT
GTCTTCAACACCGCGGTTGAAGATTGAACATAATCTAGGAATCACTTGAAGGTTGAACTG
CGCAAGATCCCCGGATGATGGTGACAGGTTGCCTGCTGATCCTGCCAACTTTGTGCTGCA
TGTTTCTTGGCCAGCTCTCAGGAATGGAAACAGATATGAGAATTCATCATGAGCCCTCGC
TGAAGAACCACAATTGGTGATTGTTAATCAAGATCAATGCTTTGAGACTCAATTTTTCTG
CAAACCGAGGCTCATCTATGACAGCAAATTGGTCAACTTTTAGCAGACAATCAAGTTCGT
GTACATACATCCTCTCGGTAGTTCAGGATTAAGGAGCATAGTAGTGAGCAACTGTATATA
TGATTGGTTGTAGGACTCGGGAAATTCAACGTTTTTGTATCCGGTCAGTTTGGG

CDS

657 bp

>Os01t0579600-01 Similar to Calcineurin B-like protein 9.
ATGGAGTCGGGCTACGGCTTCCGCTTCTCCGACGACGACGTGGAGTCGGCGAGCTCGCTG
ACGGTGGGGGAGCGGCTGTGCGCGGCGTTCCTGCCGTTCGTCGCCATTGCCGAGGCCGTC
TTCTTCGCGCTCACCGACTGCCTCGCCGACCTCCTCCCGCCGTCCGCCGCCGCCTCCCGC
CACCGCCGCTCCGCCGCTTCCTCCTACCTCGCCGCCGTCGCCAGGAAATGGAACCACCAG
CAGCGTGGCAGGGTCGGCATCGGCTGCACCTCCCTCACCCTCCGCCAGCTCGCCCGCCTC
GCCGACGAATCCAGATGCTTCTCCGTGAACGAGGTGGAGGCGCTGTTCGAGCTCTACAAG
AAGATCAGCTGCTCCATCATCGACGACGGACTCATCCACAAGGAAGAGCTCCAGCTGGCA
TTGTTTAAGACTCCAAGCGGCCAGAATCTTTTTCTTGATAGGGTTTTTGATTTATTTGAT
GAAAAGAAAAATGGTGTAATAGAGTTTGATGAGTTTATTCATGCTCTTAGCGTCTTCCAT
CCATTGGCACCATTGGAAGACAAGATAAATTGTAAGTACACTTCTTTCAGACACTACCTT
CTTAAATTCATGTATCGAGGTATATTTACAATAAGGCCTCCCTTTGGATTGTTTTAG

Protein

218 aa

>Os01t0579600-01 Similar to Calcineurin B-like protein 9.
MESGYGFRFSDDDVESASSLTVGERLCAAFLPFVAIAEAVFFALTDCLADLLPPSAAASR
HRRSAASSYLAAVARKWNHQQRGRVGIGCTSLTLRQLARLADESRCFSVNEVEALFELYK
KISCSIIDDGLIHKEELQLALFKTPSGQNLFLDRVFDLFDEKKNGVIEFDEFIHALSVFH
PLAPLEDKINCKYTSFRHYLLKFMYRGIFTIRPPFGLF*

5'UTR

chr01:22427835..22427887 (+ strand) : 53 bp

CDS

chr01:22427888..22427929 (+ strand) : 42 bp

chr01:22428029..22428305 (+ strand) : 277 bp

chr01:22428430..22428512 (+ strand) : 83 bp

chr01:22429268..22429327 (+ strand) : 60 bp

chr01:22429500..22429694 (+ strand) : 195 bp

3'UTR

chr01:22429695..22429923 (+ strand) : 229 bp

chr01:22430015..22430127 (+ strand) : 113 bp

chr01:22430311..22430752 (+ strand) : 442 bp

FASTA

>Os01t0579600-01 class=Sequence position=chr01:22427835..22430752 (+ strand)
GATGGGGAGA GGCGGGGTGA GAGAGAAGCG CACGGGTGAT TGATCTTGCA TCCATGGAGT CGGGCTACGG CTTCCGCTTC
TCCGACGACG ACGTGGTGGG TCGGTGGCTC AGCTACCTGT TCGTCGCCGG TCGCCGGCGG CGCTGCCGTT TCTTGGAGCT
ATGTTTGATT GGATTTTGGA TTTTGGATTT GCAGGAGTCG GCGAGCTCGC TGACGGTGGG GGAGCGGCTG TGCGCGGCGT
TCCTGCCGTT CGTCGCCATT GCCGAGGCCG TCTTCTTCGC GCTCACCGAC TGCCTCGCCG ACCTCCTCCC GCCGTCCGCC
GCCGCCTCCC GCCACCGCCG CTCCGCCGCT TCCTCCTACC TCGCCGCCGT CGCCAGGAAA TGGAACCACC AGCAGCGTGG
CAGGGTCGGC ATCGGCTGCA CCTCCCTCAC CCTCCGCCAG CTCGCCCGCC TCGCCGACGA ATCCAGATGC TGTAATCTCT
AATTTCACCT CACCCCCCTC CCATTGTTTG TATCGCCTTC TTCTTCTTCT CGAGTCCAAT TTCGCAATGT GGTCCGATCT
GATCTGGTGT TTGGTGTCGA TCGCATCGGG TCAAGTCTCC GTGAACGAGG TGGAGGCGCT GTTCGAGCTC TACAAGAAGA
TCAGCTGCTC CATCATCGAC GACGGACTCA TCCACAAGGT TTGTGTTCCT GTCAATTTGT CATTTTGGAT CAGGTTGATG
TGACAAAAAT TTCTTTCGAT ACGTTCTTTC GTGGCAAGAA TTCTCGGTGA TTATCGAATA AACTAATAGT TTTTTTTTTG
AGAGGTTATG CTCTGCACTT CGATGTCTGT TCTTGTCTTG GTCTCTGAAA ATTGGGTTCG TCAGGCGAAA AGAATGATCG
ATTGATTAGT AGTCGGCCTT AAGAAGGCAA TGTTGCAATT TGACCCAGTA AAAAAATTGC AACTAGGTGT ACTAGATCGA
CCGATCCAGA GGTGTTGCAC TGCACGCAAT GGATTAGTGG GTCACCCATG GAGCATTATT GTATTTTGGT TTCACAACCC
ATAGAATTTT TTTTGCCTCT AGTTTACTTT TTGTCACAGC TTGCATGTCG GGTGGCTCCC ATGTGCAATT TGACCATAGA
ATAGTTCCTG TTTCTCAGAT TGTTTGGTTG GCATGTTCGT TCTCATGGTA CACTATGTGA GCAACTGTAA CGCTGATTGG
TAAGGGGAAG GCATGGCATG GCTGTTTTTT CGTTAAGAAA ACACTGTAGT ATCTTTGCAA TACAAACATT CGAAGTCAAC
AGAAACCATT TAATTTGTAT TTTCAGGAGC ATCGTGATTT ATTGGAGTGA ATGTTTTTTT TAATAAAAAC TTGAGAAAGA
CAAATAAAAT CTGAAATGCT CTCTATGCTG GATTTGTCAT ACGTAACAGT TCCTATGCTG AATTGTTCTT TAGGAAGAGC
TCCAGCTGGC ATTGTTTAAG ACTCCAAGCG GCCAGAATCT TTTTCTTGAT AGGGTGAGTG TTTACTTCAT TTGCTCTCTT
TAGTACTATA AATTTTATTT GACCATTTAC CACTTTGTGC ACTATGTTTT CCATTGATCT CCTTTTAATT GTTAGTTTAT
TTCCATGGCA TGTTACTTTC AGAGGGTATA AGTATAACCA CTGAAAGAAA TTCTCTCTGA TACAGGTTTT TGATTTATTT
GATGAAAAGA AAAATGGTGT AATAGAGTTT GATGAGTTTA TTCATGCTCT TAGCGTCTTC CATCCATTGG CACCATTGGA
AGACAAGATA AATTGTAAGT ACACTTCTTT CAGACACTAC CTTCTTAAAT TCATGTATCG AGGTATATTT ACAATAAGGC
CTCCCTTTGG ATTGTTTTAG TTGCATTTAG GTTGTATGAC TTGAGACAAA CTGGGTTTAT TGAGCGTGAG GAGGTTAGTT
CATCAAGGCA CTCTGTATTA ATTTGCAACA AGTATGTTAT TTGTGTTCTA GTACAAATCT GGTAGTGACG GCATGGTCTG
TTTTGCAGGT TATGCAAATG GTTATCGCTA TTTTGTCGGA ATCTGATATG AAATTGTCAG AAGAACTTCT CGAGGCCATT
ATTGATAAGG TGATCAATCA TTTCCTCGGC TCTGTCCTAT GTGAACATGC CCTTTTTGCT GCATGGATTT AAGTTTTGCT
ACAATTTTTC TGTATTTCAG ACATTTGAAG ATGCTGATGC TGATAGGGAT GGAAAAATAA ACCAACAAGA ATGGAAGGAA
TTCGTATTGC GGCATCCTAA TCTATTGAAG AACATGACAC TGCCTTATCT AAGGTATTAA ATATGAGCTT GAGAGCTTTA
TGAACTGGAC TATTAAGTTC TGTCAAATAT ATACTGTTGC GCAGAGAAAT CTCGTCTGGA AACTACTGCT AAATTGTTTG
AAAAAAATAC CAGTCAGGAC TTCATTAAAT TCCTCGTTAT TTACTTTGTT ATTTTTTTGT CCATCTTATA CTACAGGGAC
ATCACGACAG TTTTCCCTAG TTTTGTCTTC AACACCGCGG TTGAAGATTG AACATAATCT AGGAATCACT TGAAGGTTGA
ACTGCGCAAG ATCCCCGGAT GATGGTGACA GGTTGCCTGC TGATCCTGCC AACTTTGTGC TGCATGTTTC TTGGCCAGCT
CTCAGGAATG GAAACAGATA TGAGAATTCA TCATGAGCCC TCGCTGAAGA ACCACAATTG GTGATTGTTA ATCAAGATCA
ATGCTTTGAG ACTCAATTTT TCTGCAAACC GAGGCTCATC TATGACAGCA AATTGGTCAA CTTTTAGCAG ACAATCAAGT
TCGTGTACAT ACATCCTCTC GGTAGTTCAG GATTAAGGAG CATAGTAGTG AGCAACTGTA TATATGATTG GTTGTAGGAC
TCGGGAAATT CAACGTTTTT GTATCCGGTC AGTTTGGG

Locus: Os01g0579600

Loading...

Locus: Os01g0579600

Loading...