Os01t0579600-02

Locus

Os01g0579600

Description

Similar to Isoform 2 of Calcineurin B-like protein 9.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CBL9

CGSNL Gene Name

CALCINEURIN B-LIKE PROTEIN 9

Oryzabase Gene Symbol Synonym(s)

OsCBL9

Oryzabase Gene Name Synonym(s)

Calcineurin B-like protein 9

Transcript Evidence

AK100352 (DDBJ, Best hit)

Protein Evidence

Q3HRN8 (UniProt)

Literature

Note

Manual Curation

Full-length cDNA

J023083G13 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0579600-02)

RiceXPro (AK100352)

Others

Oryzabase (6106)

KEGG (Os01t0579600-02)

Transcript

2923 bp

>Os01t0579600-02 Similar to Isoform 2 of Calcineurin B-like protein 9.
GAGAAGCGCACGGGTGATTGATCTTGCATCCATGGAGTCGGGCTACGGCTTCCGCTTCTC
CGACGACGACGTGGTGGGTCGGTGGCTCAGCTACCTGTTCGTCGCCGGTCGCCGGCGGCG
CTGCCGTTTCTTGGAGCTATGTTTGATTGGATTTTGGATTTTGGATTTGCAGGAGTCGGC
GAGCTCGCTGACGGTGGGGGAGCGGCTGTGCGCGGCGTTCCTGCCGTTCGTCGCCATTGC
CGAGGCCGTCTTCTTCGCGCTCACCGACTGCCTCGCCGACCTCCTCCCGCCGTCCGCCGC
CGCCTCCCGCCACCGCCGCTCCGCCGCTTCCTCCTACCTCGCCGCCGTCGCCAGGAAATG
GAACCACCAGCAGCGTGGCAGGGTCGGCATCGGCTGCACCTCCCTCACCCTCCGCCAGCT
CGCCCGCCTCGCCGACGAATCCAGATGCTGTAATCTCTAATTTCACCTCACCCCCCTCCC
ATTGTTTGTATCGCCTTCTTCTTCTTCTCGAGTCCAATTTCGCAATGTGGTCCGATCTGA
TCTGGTGTTTGGTGTCGATCGCATCGGGTCAAGTCTCCGTGAACGAGGTGGAGGCGCTGT
TCGAGCTCTACAAGAAGATCAGCTGCTCCATCATCGACGACGGACTCATCCACAAGGTTT
GTGTTCCTGTCAATTTGTCATTTTGGATCAGGTTGATGTGACAAAAATTTCTTTCGATAC
GTTCTTTCGTGGCAAGAATTCTCGGTGATTATCGAATAAACTAATAGTTTTTTTTTTGAG
AGGTTATGCTCTGCACTTCGATGTCTGTTCTTGTCTTGGTCTCTGAAAATTGGGTTCGTC
AGGCGAAAAGAATGATCGATTGATTAGTAGTCGGCCTTAAGAAGGCAATGTTGCAATTTG
ACCCAGTAAAAAAATTGCAACTAGGTGTACTAGATCGACCGATCCAGAGGTGTTGCACTG
CACGCAATGGATTAGTGGGTCACCCATGGAGCATTATTGTATTTTGGTTTCACAACCCAT
AGAATTTTTTTTGCCTCTAGTTTACTTTTTGTCACAGCTTGCATGTCGGGTGGCTCCCAT
GTGCAATTTGACCATAGAATAGTTCCTGTTTCTCAGATTGTTTGGTTGGCATGTTCGTTC
TCATGGTACACTATGTGAGCAACTGTAACGCTGATTGGTAAGGGGAAGGCATGGCATGGC
TGTTTTTTCGTTAAGAAAACACTGTAGTATCTTTGCAATACAAACATTCGAAGTCAACAG
AAACCATTTAATTTGTATTTTCAGGAGCATCGTGATTTATTGGAGTGAATGTTTTTTTTA
ATAAAAACTTGAGAAAGACAAATAAAATCTGAAATGCTCTCTATGCTGGATTTGTCATAC
GTAACAGTTCCTATGCTGAATTGTTCTTTAGGAAGAGCTCCAGCTGGCATTGTTTAAGAC
TCCAAGCGGCCAGAATCTTTTTCTTGATAGGGTGAGTGTTTACTTCATTTGCTCTCTTTA
GTACTATAAATTTTATTTGACCATTTACCACTTTGTGCACTATGTTTTCCATTGATCTCC
TTTTAATTGTTAGTTTATTTCCATGGCATGTTACTTTCAGAGGGTATAAGTATAACCACT
GAAAGAAATTCTCTCTGATACAGGTTTTTGATTTATTTGATGAAAAGAAAAATGGTGTAA
TAGAGTTTGATGAGTTTATTCATGCTCTTAGCGTCTTCCATCCATTGGCACCATTGGAAG
ACAAGATAAATTGTAAGTACACTTCTTTCAGACACTACCTTCTTAAATTCATGTATCGAG
GTATATTTACAATAAGGCCTCCCTTTGGATTGTTTTAGTTGCATTTAGGTTGTATGACTT
GAGACAAACTGGGTTTATTGAGCGTGAGGAGGTTAGTTCATCAAGGCACTCTGTATTAAT
TTGCAACAAGTATGTTATTTGTGTTCTAGTACAAATCTGGTAGTGACGGCATGGTCTGTT
TTGCAGGTTATGCAAATGGTTATCGCTATTTTGTCGGAATCTGATATGAAATTGTCAGAA
GAACTTCTCGAGGCCATTATTGATAAGGTGATCAATCATTTCCTCGGCTCTGTCCTATGT
GAACATGCCCTTTTTGCTGCATGGATTTAAGTTTTGCTACAATTTTTCTGTATTTCAGAC
ATTTGAAGATGCTGATGCTGATAGGGATGGAAAAATAAACCAACAAGAATGGAAGGAATT
CGTATTGCGGCATCCTAATCTATTGAAGAACATGACACTGCCTTATCTAAGGTATTAAAT
ATGAGCTTGAGAGCTTTATGAACTGGACTATTAAGTTCTGTCAAATATATACTGTTGCGC
AGAGAAATCTCGTCTGGAAACTACTGCTAAATTGTTTGAAAAAAATACCAGTCAGGACTT
CATTAAATTCCTCGTTATTTACTTTGTTATTTTTTTGTCCATCTTATACTACAGGGACAT
CACGACAGTTTTCCCTAGTTTTGTCTTCAACACCGCGGTTGAAGATTGAACATAATCTAG
GAATCACTTGAAGGTTGAACTGCGCAAGATCCCCGGATGATGGTGACAGGTTGCCTGCTG
ATCCTGCCAACTTTGTGCTGCATGTTTCTTGGCCAGCTCTCAGGAATGGAAACAGATATG
AGAATTCATCATGAGCCCTCGCTGAAGAACCACAATTGGTGATTGTTAATCAAGATCAAT
GCTTTGAGACTCAATTTTTCTGCAAACCGAGGCTCATCTATGACAGCAAATTGGTCAACT
TTTAGCAGACAATCAAGTTCGTGTACATACATCCTCTCGGTAGTTCAGGATTAAGGAGCA
TAGTAGTGAGCAACTGTATATATGATTGGTTGTAGGACTCGGGAAATTCAACGTTTTTGT
ATCCGGTCAGTTTGGGAATTATCATTCCAGTTTATCTTTTTAC

CDS

429 bp

>Os01t0579600-02 Similar to Isoform 2 of Calcineurin B-like protein 9.
ATGGAGTCGGGCTACGGCTTCCGCTTCTCCGACGACGACGTGGTGGGTCGGTGGCTCAGC
TACCTGTTCGTCGCCGGTCGCCGGCGGCGCTGCCGTTTCTTGGAGCTATGTTTGATTGGA
TTTTGGATTTTGGATTTGCAGGAGTCGGCGAGCTCGCTGACGGTGGGGGAGCGGCTGTGC
GCGGCGTTCCTGCCGTTCGTCGCCATTGCCGAGGCCGTCTTCTTCGCGCTCACCGACTGC
CTCGCCGACCTCCTCCCGCCGTCCGCCGCCGCCTCCCGCCACCGCCGCTCCGCCGCTTCC
TCCTACCTCGCCGCCGTCGCCAGGAAATGGAACCACCAGCAGCGTGGCAGGGTCGGCATC
GGCTGCACCTCCCTCACCCTCCGCCAGCTCGCCCGCCTCGCCGACGAATCCAGATGCTGT
AATCTCTAA

Protein

142 aa

>Os01t0579600-02 Similar to Isoform 2 of Calcineurin B-like protein 9.
MESGYGFRFSDDDVVGRWLSYLFVAGRRRRCRFLELCLIGFWILDLQESASSLTVGERLC
AAFLPFVAIAEAVFFALTDCLADLLPPSAAASRHRRSAASSYLAAVARKWNHQQRGRVGI
GCTSLTLRQLARLADESRCCNL*

5'UTR

chr01:22427857..22427887 (+ strand) : 31 bp

CDS

chr01:22427888..22428316 (+ strand) : 429 bp

3'UTR

chr01:22428317..22430779 (+ strand) : 2463 bp

FASTA

>Os01t0579600-02 class=Sequence position=chr01:22427857..22430779 (+ strand)
GAGAAGCGCA CGGGTGATTG ATCTTGCATC CATGGAGTCG GGCTACGGCT TCCGCTTCTC CGACGACGAC GTGGTGGGTC
GGTGGCTCAG CTACCTGTTC GTCGCCGGTC GCCGGCGGCG CTGCCGTTTC TTGGAGCTAT GTTTGATTGG ATTTTGGATT
TTGGATTTGC AGGAGTCGGC GAGCTCGCTG ACGGTGGGGG AGCGGCTGTG CGCGGCGTTC CTGCCGTTCG TCGCCATTGC
CGAGGCCGTC TTCTTCGCGC TCACCGACTG CCTCGCCGAC CTCCTCCCGC CGTCCGCCGC CGCCTCCCGC CACCGCCGCT
CCGCCGCTTC CTCCTACCTC GCCGCCGTCG CCAGGAAATG GAACCACCAG CAGCGTGGCA GGGTCGGCAT CGGCTGCACC
TCCCTCACCC TCCGCCAGCT CGCCCGCCTC GCCGACGAAT CCAGATGCTG TAATCTCTAA TTTCACCTCA CCCCCCTCCC
ATTGTTTGTA TCGCCTTCTT CTTCTTCTCG AGTCCAATTT CGCAATGTGG TCCGATCTGA TCTGGTGTTT GGTGTCGATC
GCATCGGGTC AAGTCTCCGT GAACGAGGTG GAGGCGCTGT TCGAGCTCTA CAAGAAGATC AGCTGCTCCA TCATCGACGA
CGGACTCATC CACAAGGTTT GTGTTCCTGT CAATTTGTCA TTTTGGATCA GGTTGATGTG ACAAAAATTT CTTTCGATAC
GTTCTTTCGT GGCAAGAATT CTCGGTGATT ATCGAATAAA CTAATAGTTT TTTTTTTGAG AGGTTATGCT CTGCACTTCG
ATGTCTGTTC TTGTCTTGGT CTCTGAAAAT TGGGTTCGTC AGGCGAAAAG AATGATCGAT TGATTAGTAG TCGGCCTTAA
GAAGGCAATG TTGCAATTTG ACCCAGTAAA AAAATTGCAA CTAGGTGTAC TAGATCGACC GATCCAGAGG TGTTGCACTG
CACGCAATGG ATTAGTGGGT CACCCATGGA GCATTATTGT ATTTTGGTTT CACAACCCAT AGAATTTTTT TTGCCTCTAG
TTTACTTTTT GTCACAGCTT GCATGTCGGG TGGCTCCCAT GTGCAATTTG ACCATAGAAT AGTTCCTGTT TCTCAGATTG
TTTGGTTGGC ATGTTCGTTC TCATGGTACA CTATGTGAGC AACTGTAACG CTGATTGGTA AGGGGAAGGC ATGGCATGGC
TGTTTTTTCG TTAAGAAAAC ACTGTAGTAT CTTTGCAATA CAAACATTCG AAGTCAACAG AAACCATTTA ATTTGTATTT
TCAGGAGCAT CGTGATTTAT TGGAGTGAAT GTTTTTTTTA ATAAAAACTT GAGAAAGACA AATAAAATCT GAAATGCTCT
CTATGCTGGA TTTGTCATAC GTAACAGTTC CTATGCTGAA TTGTTCTTTA GGAAGAGCTC CAGCTGGCAT TGTTTAAGAC
TCCAAGCGGC CAGAATCTTT TTCTTGATAG GGTGAGTGTT TACTTCATTT GCTCTCTTTA GTACTATAAA TTTTATTTGA
CCATTTACCA CTTTGTGCAC TATGTTTTCC ATTGATCTCC TTTTAATTGT TAGTTTATTT CCATGGCATG TTACTTTCAG
AGGGTATAAG TATAACCACT GAAAGAAATT CTCTCTGATA CAGGTTTTTG ATTTATTTGA TGAAAAGAAA AATGGTGTAA
TAGAGTTTGA TGAGTTTATT CATGCTCTTA GCGTCTTCCA TCCATTGGCA CCATTGGAAG ACAAGATAAA TTGTAAGTAC
ACTTCTTTCA GACACTACCT TCTTAAATTC ATGTATCGAG GTATATTTAC AATAAGGCCT CCCTTTGGAT TGTTTTAGTT
GCATTTAGGT TGTATGACTT GAGACAAACT GGGTTTATTG AGCGTGAGGA GGTTAGTTCA TCAAGGCACT CTGTATTAAT
TTGCAACAAG TATGTTATTT GTGTTCTAGT ACAAATCTGG TAGTGACGGC ATGGTCTGTT TTGCAGGTTA TGCAAATGGT
TATCGCTATT TTGTCGGAAT CTGATATGAA ATTGTCAGAA GAACTTCTCG AGGCCATTAT TGATAAGGTG ATCAATCATT
TCCTCGGCTC TGTCCTATGT GAACATGCCC TTTTTGCTGC ATGGATTTAA GTTTTGCTAC AATTTTTCTG TATTTCAGAC
ATTTGAAGAT GCTGATGCTG ATAGGGATGG AAAAATAAAC CAACAAGAAT GGAAGGAATT CGTATTGCGG CATCCTAATC
TATTGAAGAA CATGACACTG CCTTATCTAA GGTATTAAAT ATGAGCTTGA GAGCTTTATG AACTGGACTA TTAAGTTCTG
TCAAATATAT ACTGTTGCGC AGAGAAATCT CGTCTGGAAA CTACTGCTAA ATTGTTTGAA AAAAATACCA GTCAGGACTT
CATTAAATTC CTCGTTATTT ACTTTGTTAT TTTTTTGTCC ATCTTATACT ACAGGGACAT CACGACAGTT TTCCCTAGTT
TTGTCTTCAA CACCGCGGTT GAAGATTGAA CATAATCTAG GAATCACTTG AAGGTTGAAC TGCGCAAGAT CCCCGGATGA
TGGTGACAGG TTGCCTGCTG ATCCTGCCAA CTTTGTGCTG CATGTTTCTT GGCCAGCTCT CAGGAATGGA AACAGATATG
AGAATTCATC ATGAGCCCTC GCTGAAGAAC CACAATTGGT GATTGTTAAT CAAGATCAAT GCTTTGAGAC TCAATTTTTC
TGCAAACCGA GGCTCATCTA TGACAGCAAA TTGGTCAACT TTTAGCAGAC AATCAAGTTC GTGTACATAC ATCCTCTCGG
TAGTTCAGGA TTAAGGAGCA TAGTAGTGAG CAACTGTATA TATGATTGGT TGTAGGACTC GGGAAATTCA ACGTTTTTGT
ATCCGGTCAG TTTGGGAATT ATCATTCCAG TTTATCTTTT TAC

Locus: Os01g0579600

Loading...

Locus: Os01g0579600

Loading...