Os01t0579600-03

Locus

Os01g0579600

Description

Similar to Calcineurin B-like protein 9.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CBL9

CGSNL Gene Name

CALCINEURIN B-LIKE PROTEIN 9

Oryzabase Gene Symbol Synonym(s)

OsCBL9

Oryzabase Gene Name Synonym(s)

Calcineurin B-like protein 9

Transcript Evidence

AK111936 (DDBJ, Best hit)

Protein Evidence

Q3HRN8 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Molecular Function: calcium ion binding (GO:0005509)

Functional domain (InterPro)

Calcium-binding EF-hand (IPR002048)

EF-hand-like domain (IPR011992)

EF-Hand 1, calcium-binding site (IPR018247)

EF-HAND 2 (IPR018249)

Full-length cDNA

001-001-E04 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0579600-03)

Others

Oryzabase (6106)

Transcript

901 bp

>Os01t0579600-03 Similar to Calcineurin B-like protein 9.
CCATTGGCACCATTGGAAGACAAGATAAATTGTAAGTACACTTCTTTCAGACACTACCTT
CTTAAATTCATGTATCGAGGTATATTTACAATAAGGCCTCCCTTTGGATTGTTTTAGTTG
CATTTAGGTTGTATGACTTGAGACAAACTGGGTTTATTGAGCGTGAGGAGGTTAGTTCAT
CAAGGCACTCTGTATTAATTTGCAACAAGTATGTTATTTGTGTTCTAGTACAAATCTGGT
AGTGACGGCATGGTCTGTTTTGCAGGTTATGCAAATGGTTATCGCTATTTTGTCGGAATC
TGATATGAAATTGTCAGAAGAACTTCTCGAGGCCATTATTGATAAGACATTTGAAGATGC
TGATGCTGATAGGGATGGAAAAATAAACCAACAAGAATGGAAGGAATTCGTATTGCGGCA
TCCTAATCTATTGAAGAACATGACACTGCCTTATCTAAGGGACATCACGACAGTTTTCCC
TAGTTTTGTCTTCAACACCGCGGTTGAAGATTGAACATAATCTAGGAATCACTTGAAGGT
TGAACTGCGCAAGATCCCCGGATGATGGTGACAGGTTGCCTGCTGATCCTGCCAACTTTG
TGCTGCATGTTTCTTGGCCAGCTCTCAGGAATGGAAACAGATATGAGAATTCATCATGAG
CCCTCGCTGAAGAACCACAATTGGTGATTGTTAATCAAGATCAATGCTTTGAGACTCAAT
TTTTCTGCAAACCGAGGCTCATCTATGACAGCAAATTGGTCAACTTTTAGCAGACAATCA
AGTTCGTGTACATACATCCTCTCGGTAGTTCAGGATTAAGGAGCATAGTAGTGAGCAACT
GTATATATGATTGGTTGTAGGACTCGGGAAATTCAACGTTTTTGTATCCGGTCAGTTTGG
G

CDS

339 bp

>Os01t0579600-03 Similar to Calcineurin B-like protein 9.
TTCATCAAGGCACTCTGTATTAATTTGCAACAAGTATGTTATTTGTGTTCTAGTACAAAT
CTGGTAGTGACGGCATGGTCTGTTTTGCAGGTTATGCAAATGGTTATCGCTATTTTGTCG
GAATCTGATATGAAATTGTCAGAAGAACTTCTCGAGGCCATTATTGATAAGACATTTGAA
GATGCTGATGCTGATAGGGATGGAAAAATAAACCAACAAGAATGGAAGGAATTCGTATTG
CGGCATCCTAATCTATTGAAGAACATGACACTGCCTTATCTAAGGGACATCACGACAGTT
TTCCCTAGTTTTGTCTTCAACACCGCGGTTGAAGATTGA

Protein

112 aa

>Os01t0579600-03 Similar to Calcineurin B-like protein 9.
FIKALCINLQQVCYLCSSTNLVVTAWSVLQVMQMVIAILSESDMKLSEELLEAIIDKTFE
DADADRDGKINQQEWKEFVLRHPNLLKNMTLPYLRDITTVFPSFVFNTAVED*

5'UTR

chr01:22429578..22429752 (+ strand) : 175 bp

CDS

chr01:22429753..22429923 (+ strand) : 171 bp

chr01:22430015..22430127 (+ strand) : 113 bp

chr01:22430311..22430365 (+ strand) : 55 bp

3'UTR

chr01:22430366..22430752 (+ strand) : 387 bp

FASTA

>Os01t0579600-03 class=Sequence position=chr01:22429578..22430752 (+ strand)
CCATTGGCAC CATTGGAAGA CAAGATAAAT TGTAAGTACA CTTCTTTCAG ACACTACCTT CTTAAATTCA TGTATCGAGG
TATATTTACA ATAAGGCCTC CCTTTGGATT GTTTTAGTTG CATTTAGGTT GTATGACTTG AGACAAACTG GGTTTATTGA
GCGTGAGGAG GTTAGTTCAT CAAGGCACTC TGTATTAATT TGCAACAAGT ATGTTATTTG TGTTCTAGTA CAAATCTGGT
AGTGACGGCA TGGTCTGTTT TGCAGGTTAT GCAAATGGTT ATCGCTATTT TGTCGGAATC TGATATGAAA TTGTCAGAAG
AACTTCTCGA GGCCATTATT GATAAGGTGA TCAATCATTT CCTCGGCTCT GTCCTATGTG AACATGCCCT TTTTGCTGCA
TGGATTTAAG TTTTGCTACA ATTTTTCTGT ATTTCAGACA TTTGAAGATG CTGATGCTGA TAGGGATGGA AAAATAAACC
AACAAGAATG GAAGGAATTC GTATTGCGGC ATCCTAATCT ATTGAAGAAC ATGACACTGC CTTATCTAAG GTATTAAATA
TGAGCTTGAG AGCTTTATGA ACTGGACTAT TAAGTTCTGT CAAATATATA CTGTTGCGCA GAGAAATCTC GTCTGGAAAC
TACTGCTAAA TTGTTTGAAA AAAATACCAG TCAGGACTTC ATTAAATTCC TCGTTATTTA CTTTGTTATT TTTTTGTCCA
TCTTATACTA CAGGGACATC ACGACAGTTT TCCCTAGTTT TGTCTTCAAC ACCGCGGTTG AAGATTGAAC ATAATCTAGG
AATCACTTGA AGGTTGAACT GCGCAAGATC CCCGGATGAT GGTGACAGGT TGCCTGCTGA TCCTGCCAAC TTTGTGCTGC
ATGTTTCTTG GCCAGCTCTC AGGAATGGAA ACAGATATGA GAATTCATCA TGAGCCCTCG CTGAAGAACC ACAATTGGTG
ATTGTTAATC AAGATCAATG CTTTGAGACT CAATTTTTCT GCAAACCGAG GCTCATCTAT GACAGCAAAT TGGTCAACTT
TTAGCAGACA ATCAAGTTCG TGTACATACA TCCTCTCGGT AGTTCAGGAT TAAGGAGCAT AGTAGTGAGC AACTGTATAT
ATGATTGGTT GTAGGACTCG GGAAATTCAA CGTTTTTGTA TCCGGTCAGT TTGGG

Locus: Os01g0579600

Loading...

Locus: Os01g0579600

Loading...