Os01t0580400-01

Locus

Os01g0580400

Description

Histone-fold domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

HAP5J

CGSNL Gene Name

HAP5J SUBUNIT OF CCAAT-BOX BINDING COMPLEX

Oryzabase Gene Symbol Synonym(s)

OsHAP5J, OsNF-YC8, NF-YC8, NFYC8

Oryzabase Gene Name Synonym(s)

NUCLEAR FACTOR-Y subunit C8, NUCLEAR FACTOR-Y subunit NF-YC8, NF-YC transcription factor 8, NF-YC subunit 8, NF-YC family 8

Transcript Evidence

AK242120 (DDBJ, Best hit)

Protein Evidence

NP_001043407.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Cellular Component: intracellular (GO:0005622)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: sequence-specific DNA binding (GO:0043565)

Functional domain (InterPro)

Transcription factor CBF/NF-Y/archaeal histone (IPR003958)

Histone-fold (IPR009072)

Full-length cDNA

J075147C14 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0580400-01)

Others

Oryzabase (20925)

KEGG (Os01t0580400-01)

Transcript

1725 bp

>Os01t0580400-01 Histone-fold domain containing protein.
GTGTCATATTGTGTTCATCTTCATACTACCAACCAATTAGTGCTAATAGGTAGCATTTTC
TGTAGTTGCAGCTCAAGTAAGGTCTATTATTCAGAGCAACGAAGGGAAGGAATGGAGCAA
ACTTTGGACGTACCTAGATCGTTGAGACTACTGGCGCCAAAAGCTCAACAACAAATGGAT
GAATTTTGGAGGGATCGACAAAAGGAGATTGAAACAACAAAGGACTTTAGCGAGCATGCG
ATCCCTATGGCCCGCTTGAAGAAGATCGTATCTTCTCAAAAGGGTAACATGATGATGACC
TTTGACATGCCAGCATTCTTATCGAAGATGTGTGAGCTCTTCGTACAAGAACTTGCTGTG
CGTGCATGGGCATCTGCTCAATCCCATAATCGTTGCATCATACTAGACACGGATATTGCT
AAAGCCATTGCCTCCACAGAGTCTTATGACTTTCTTGTTGATATCCTCCATAATCATCGT
GTGAAACACAAATCCACTCCTTGTTCTACACTTACTACAAAGCGTTGTAGGTTAGTCGAT
CAACCTTCCACATCTCACATGCCCTACCAACATCAGCTGCCACAATTTGCTCCTACATAT
ACTCCGGCCATCCCTATTACTCCTAGTTTAATGCCACCAATTTCTCACTATATACCGTTC
CAATATCCATCCTTATCACAAGAAGTGTCCCCGATGATGGCTTCTGCACCCATAGTGAAT
AGATCAATGTTGCTCATTCACAACATAGCAAGGGGTCTAGGCTTACAAGGAAACAATATC
AGCACGTTCGCCAACAATAATATCCCAGACAATATTGTTGGTTGTAGTAGCCCCACAGTT
CTTGCAAGTATGATGAGTCCTGCTTTACTAGAAGTTGCAGGGACATCACTAAATCCACCA
AACTCTCATTCCATCTGCACAATGAACATGATCAACTCGAGTGATCCTAGTGGATCTAGT
ATTGGTGACATTAATGTTGCAAATCAAGCAAGTCTTGCTCCCTCTGGACGTTTTAACCCT
GCTATCCTTCGAGAGTCATCATGTCCTTCGTTCTTACATAGTAACAATGACACAATTGTT
GCTATACCGGAGGGTGTAGATATTAGTGGCACCATGGATGTTGCTAGTGATGTTGCTGCT
ATAGTTATCAATGGTCAAGAAGAACATGAGAGGGAAACAAATGTTGAGCATCATCAGCAA
AATGAGATATATGAAAGCATTGATATAGGAATAATCAATGCAAGTGTTGCGGATGATAAT
AAATATAGTATTAGCTGGGATGAATTGGGAATGGCTGATGATTCATTGCTAGACAAATTT
TTGGAGGAGTTTCAAGTAAGAAATGACGGTGTTTTGCGCACTGGGATTGAGTTGCATGAA
GACCCATTCCTTGGTGACGTGATGTTAGCAAACCCAAGTACAAGCAATGCCAATAAGTAA
TTTAGTTGGCAAGTTTTGTTTATATCTCTTTTGTAAGAATGAGGTTGTAACTTTTTCTTG
TTGAATATAATGTTGCAGCGGCGGACCTATGTGGGGTGCCGGGTGTGCACCGGCATAAAA
ATATAGTATGTAGTATTAGCAGCGGGCCAAATCAATAGATTGGTGCCTCGTTGGATCAAA
AGCAAGGCCTACAAGGCCCAACGTGCTAGCAGGGAGGCAGCCCAATCTGCTAGCCAATGT
GCCATGTGCTGCTAGAGTCTGGgagaaaattggattatattatcg

CDS

1329 bp

>Os01t0580400-01 Histone-fold domain containing protein.
ATGGAGCAAACTTTGGACGTACCTAGATCGTTGAGACTACTGGCGCCAAAAGCTCAACAA
CAAATGGATGAATTTTGGAGGGATCGACAAAAGGAGATTGAAACAACAAAGGACTTTAGC
GAGCATGCGATCCCTATGGCCCGCTTGAAGAAGATCGTATCTTCTCAAAAGGGTAACATG
ATGATGACCTTTGACATGCCAGCATTCTTATCGAAGATGTGTGAGCTCTTCGTACAAGAA
CTTGCTGTGCGTGCATGGGCATCTGCTCAATCCCATAATCGTTGCATCATACTAGACACG
GATATTGCTAAAGCCATTGCCTCCACAGAGTCTTATGACTTTCTTGTTGATATCCTCCAT
AATCATCGTGTGAAACACAAATCCACTCCTTGTTCTACACTTACTACAAAGCGTTGTAGG
TTAGTCGATCAACCTTCCACATCTCACATGCCCTACCAACATCAGCTGCCACAATTTGCT
CCTACATATACTCCGGCCATCCCTATTACTCCTAGTTTAATGCCACCAATTTCTCACTAT
ATACCGTTCCAATATCCATCCTTATCACAAGAAGTGTCCCCGATGATGGCTTCTGCACCC
ATAGTGAATAGATCAATGTTGCTCATTCACAACATAGCAAGGGGTCTAGGCTTACAAGGA
AACAATATCAGCACGTTCGCCAACAATAATATCCCAGACAATATTGTTGGTTGTAGTAGC
CCCACAGTTCTTGCAAGTATGATGAGTCCTGCTTTACTAGAAGTTGCAGGGACATCACTA
AATCCACCAAACTCTCATTCCATCTGCACAATGAACATGATCAACTCGAGTGATCCTAGT
GGATCTAGTATTGGTGACATTAATGTTGCAAATCAAGCAAGTCTTGCTCCCTCTGGACGT
TTTAACCCTGCTATCCTTCGAGAGTCATCATGTCCTTCGTTCTTACATAGTAACAATGAC
ACAATTGTTGCTATACCGGAGGGTGTAGATATTAGTGGCACCATGGATGTTGCTAGTGAT
GTTGCTGCTATAGTTATCAATGGTCAAGAAGAACATGAGAGGGAAACAAATGTTGAGCAT
CATCAGCAAAATGAGATATATGAAAGCATTGATATAGGAATAATCAATGCAAGTGTTGCG
GATGATAATAAATATAGTATTAGCTGGGATGAATTGGGAATGGCTGATGATTCATTGCTA
GACAAATTTTTGGAGGAGTTTCAAGTAAGAAATGACGGTGTTTTGCGCACTGGGATTGAG
TTGCATGAAGACCCATTCCTTGGTGACGTGATGTTAGCAAACCCAAGTACAAGCAATGCC
AATAAGTAA

Protein

443 aa

>Os01t0580400-01 Histone-fold domain containing protein.
MEQTLDVPRSLRLLAPKAQQQMDEFWRDRQKEIETTKDFSEHAIPMARLKKIVSSQKGNM
MMTFDMPAFLSKMCELFVQELAVRAWASAQSHNRCIILDTDIAKAIASTESYDFLVDILH
NHRVKHKSTPCSTLTTKRCRLVDQPSTSHMPYQHQLPQFAPTYTPAIPITPSLMPPISHY
IPFQYPSLSQEVSPMMASAPIVNRSMLLIHNIARGLGLQGNNISTFANNNIPDNIVGCSS
PTVLASMMSPALLEVAGTSLNPPNSHSICTMNMINSSDPSGSSIGDINVANQASLAPSGR
FNPAILRESSCPSFLHSNNDTIVAIPEGVDISGTMDVASDVAAIVINGQEEHERETNVEH
HQQNEIYESIDIGIINASVADDNKYSISWDELGMADDSLLDKFLEEFQVRNDGVLRTGIE
LHEDPFLGDVMLANPSTSNANK*

5'UTR

chr01:22476424..22476504 (- strand) : 81 bp

chr01:22476182..22476211 (- strand) : 30 bp

CDS

chr01:22474853..22476181 (- strand) : 1329 bp

3'UTR

chr01:22474568..22474852 (- strand) : 285 bp

FASTA

>Os01t0580400-01 class=Sequence position=chr01:22474568..22476504 (- strand)
GTGTCATATT GTGTTCATCT TCATACTACC AACCAATTAG TGCTAATAGG TAGCATTTTC TGTAGTTGCA GCTCAAGTAA
GGTAATGCAC CTACTAGCTT ATTATTCTTG TGCCTAGTAT TAATTAGTTT TTGTACTGGT ACTTGTGAAA ATTTGTGATT
TGAGCAATGC TATTTGATTT GTAATTAAGC TAGCTATCTC TTTTTGTTAG ACTGCAATGT AACATCGTTT TGCTAATTTT
TGAACTAGAA AAGTAAGAAA AAGAAGTAAC AAAAGTGTGT GCTTGCTATG TAGGTCTATT ATTCAGAGCA ACGAAGGGAA
GGAATGGAGC AAACTTTGGA CGTACCTAGA TCGTTGAGAC TACTGGCGCC AAAAGCTCAA CAACAAATGG ATGAATTTTG
GAGGGATCGA CAAAAGGAGA TTGAAACAAC AAAGGACTTT AGCGAGCATG CGATCCCTAT GGCCCGCTTG AAGAAGATCG
TATCTTCTCA AAAGGGTAAC ATGATGATGA CCTTTGACAT GCCAGCATTC TTATCGAAGA TGTGTGAGCT CTTCGTACAA
GAACTTGCTG TGCGTGCATG GGCATCTGCT CAATCCCATA ATCGTTGCAT CATACTAGAC ACGGATATTG CTAAAGCCAT
TGCCTCCACA GAGTCTTATG ACTTTCTTGT TGATATCCTC CATAATCATC GTGTGAAACA CAAATCCACT CCTTGTTCTA
CACTTACTAC AAAGCGTTGT AGGTTAGTCG ATCAACCTTC CACATCTCAC ATGCCCTACC AACATCAGCT GCCACAATTT
GCTCCTACAT ATACTCCGGC CATCCCTATT ACTCCTAGTT TAATGCCACC AATTTCTCAC TATATACCGT TCCAATATCC
ATCCTTATCA CAAGAAGTGT CCCCGATGAT GGCTTCTGCA CCCATAGTGA ATAGATCAAT GTTGCTCATT CACAACATAG
CAAGGGGTCT AGGCTTACAA GGAAACAATA TCAGCACGTT CGCCAACAAT AATATCCCAG ACAATATTGT TGGTTGTAGT
AGCCCCACAG TTCTTGCAAG TATGATGAGT CCTGCTTTAC TAGAAGTTGC AGGGACATCA CTAAATCCAC CAAACTCTCA
TTCCATCTGC ACAATGAACA TGATCAACTC GAGTGATCCT AGTGGATCTA GTATTGGTGA CATTAATGTT GCAAATCAAG
CAAGTCTTGC TCCCTCTGGA CGTTTTAACC CTGCTATCCT TCGAGAGTCA TCATGTCCTT CGTTCTTACA TAGTAACAAT
GACACAATTG TTGCTATACC GGAGGGTGTA GATATTAGTG GCACCATGGA TGTTGCTAGT GATGTTGCTG CTATAGTTAT
CAATGGTCAA GAAGAACATG AGAGGGAAAC AAATGTTGAG CATCATCAGC AAAATGAGAT ATATGAAAGC ATTGATATAG
GAATAATCAA TGCAAGTGTT GCGGATGATA ATAAATATAG TATTAGCTGG GATGAATTGG GAATGGCTGA TGATTCATTG
CTAGACAAAT TTTTGGAGGA GTTTCAAGTA AGAAATGACG GTGTTTTGCG CACTGGGATT GAGTTGCATG AAGACCCATT
CCTTGGTGAC GTGATGTTAG CAAACCCAAG TACAAGCAAT GCCAATAAGT AATTTAGTTG GCAAGTTTTG TTTATATCTC
TTTTGTAAGA ATGAGGTTGT AACTTTTTCT TGTTGAATAT AATGTTGCAG CGGCGGACCT ATGTGGGGTG CCGGGTGTGC
ACCGGCATAA AAATATAGTA TGTAGTATTA GCAGCGGGCC AAATCAATAG ATTGGTGCCT CGTTGGATCA AAAGCAAGGC
CTACAAGGCC CAACGTGCTA GCAGGGAGGC AGCCCAATCT GCTAGCCAAT GTGCCATGTG CTGCTAGAGT CTGGgagaaa
attggattat attatcg