Os01t0582400-01

Locus

Os01g0582400

Description

Similar to Multidomain cyclophilin type peptidyl-prolyl cis-trans isomerase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CYP57

CGSNL Gene Name

CYCLOPHILIN 57

Oryzabase Gene Symbol Synonym(s)

OsCYP57, OsCYP-3, OsCYP57a, OsCYP57b

Oryzabase Gene Name Synonym(s)

cyclophilin 57, cyclophilin 3

Transcript Evidence

AK069484 (DDBJ, Best hit)

Protein Evidence

NP_001148692.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein folding (GO:0006457)

Molecular Function: peptidyl-prolyl cis-trans isomerase activity (GO:0003755)

Functional domain (InterPro)

Peptidyl-prolyl cis-trans isomerase, cyclophilin-type (IPR002130)

Cyclophilin-like (IPR015891)

Peptidyl-prolyl cis-trans isomerase, cyclophilin-type, conserved site (IPR020892)

Full-length cDNA

J023019D12 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0582400-01)

RiceXPro (AK069484)

Others

Oryzabase (10072)

KEGG (Os01t0582400-01 (EC:5.2.1.8))

Transcript

1944 bp

>Os01t0582400-01 Similar to Multidomain cyclophilin type peptidyl-prolyl cis-trans isomerase.
GACGACCATACGAACCCGAGCACCCGAGCCATCCCGACCGGCCGGAGAGCGAGCCCTAGG
GCAGAGCGGCGGAGGCGGAGGCCGGAGGCGAACGGGAGGCCGGCGAGATGTCGTCGGTGT
ACGTGCTGGAGCCGCCGACGAAGGGCAAGGTGGTAGTGCAGACGACGGCCGGCCCGCTCG
ACATCGAGCTGTGGCCGAAGGAGGCCCCCAAGGCGGTGCGCAACTTCGTGCAGCTCTGCC
TCGAGGGCTACTACGACGGCACGCTCTTCCACCGCGTCATCAAGTCCTTCCTCGTCCAGG
GCGGCGACCCCACCGGCTCCGGCACCGGGGGTGAGAGCATATATGGGGCCCCATTTGCAG
ATGAGTTCCATACGCGCTTGAGGTTTAACCACAGGGGTTTAGTGGCGTGTGCCAATGCCG
GCACGCCTCACTCGAATGGGAGTCAATTCTTTATCAGCCTTGACCGTTGTGATTGGCTCG
ATAAGAAGAATACCATCTTTGGGAAGGTCACTGGCGATTCTATTTTCAACCTTCTAGCCT
TGGCTGATATCGAGACTGATAAGGATGATCGACCTGTGTATCCGCAGAAAATTCTTTCAG
TTGAGGTACTCTGGAACCCATTTGATGATATTGTTCCAAGGCAACTTAAGAAGACTGAGC
CTACTGCCAAGGGTGATATCGAGGGGAAATCAAAGAAGAAAGCCGTTAAGCAACTTAATG
TGCTTTCATTTGGAGATGAAGTAGAAGAGGAGGAGAATGAGGCAGCATCCTCTGTGAAGG
ACAAAATAAAAAGTATTCACGATGTGTTGGATGATCCTCGGTTTCTTAAAGGAGAGGCAC
CGGATGAGCAACTGACCAAGGAGCAAGAGGACAAAAAAAAGGAGACTGTTCAATCTGTCA
GGGAGGCTTTAGTATCAAAAAAATCTGACTTCAGAGAGCTAGAGCATGATTCAGAAACAG
ATGATTATCCTGACGATGAAAACGAGGAGGATTTTGATAACAGAATGCGCTCTCAAATTC
TAAGAAAACGCAGGGAGCTTGGGGACATCCGCTCTAGTGAAACCTCCAAAAAAACAGATA
AAGCACACCGTAAAGACAAGGAGTTACCAGTTCACAGGAGTGACGATGACAATGATGACG
ACAATGAAGACCACCAGCTAACCAAGTCTAGAAAATTTTCTATGAAGAAAAAAGGCATTG
GCTCAGAAGCCAGTGCTGAAAGGATGTCCAAAGGCGATGCTAATTTGCAGCTATTGAATC
CAGCTGAGCAAGAGAAGCATTTGCAAAAACAGAAAAGGCGCCGTCTTCAAGGCCGTGAAG
ATGAGACGTTAGCGAAGCTACAGAAGTTCAAGGCATCGTTTCTCAGTAAGAACCCTGCAA
CTGGTAACACAGAAAAGAAGACTGATGAAGAGGATTACACAGGGTGGCACAGCAACCGGC
TGACTTTTGAACCTGATTCTTCTAAGGATGGAATGACGAGGAAAGATGATCCAGATGACT
ATGTAGTGGTTGATCCTCTCCTTGAGAAAGGAAAACAAAAATTCAACAAGATGCAAGCAA
AGCTTAAGCGGAGAGAACGTGAATGGGCAGGCAGATCTCTGACCTGACCGCATAAGCTGC
TTGAGGTGCTTTACTGTTTCCTTCATAAGCGGCCTTCCTGAATTTTTCAGCTTACATTAA
TTTATCCTTTTTTTGCCTCTCAGAGGTGCACCGTGCAAAAGATTACCTCATATCATAACA
GTGCCACTACTGCAGTTTTGATGGTGTTGTAACTGTACACTGCGTTTCGCTATGTTGTGG
TTCATGGTAGAGGGACCACCTGTAGACTAGTGCTTTTAACATTAACATTTGTATCATTGT
CAATCAAACTGTAAATAACAATTGTTTTAAACTTAGAGGTTCATAATGCCCTTATTAAGT
TGCAGTGGTCTTTTTTTTTATTGG

CDS

1500 bp

>Os01t0582400-01 Similar to Multidomain cyclophilin type peptidyl-prolyl cis-trans isomerase.
ATGTCGTCGGTGTACGTGCTGGAGCCGCCGACGAAGGGCAAGGTGGTAGTGCAGACGACG
GCCGGCCCGCTCGACATCGAGCTGTGGCCGAAGGAGGCCCCCAAGGCGGTGCGCAACTTC
GTGCAGCTCTGCCTCGAGGGCTACTACGACGGCACGCTCTTCCACCGCGTCATCAAGTCC
TTCCTCGTCCAGGGCGGCGACCCCACCGGCTCCGGCACCGGGGGTGAGAGCATATATGGG
GCCCCATTTGCAGATGAGTTCCATACGCGCTTGAGGTTTAACCACAGGGGTTTAGTGGCG
TGTGCCAATGCCGGCACGCCTCACTCGAATGGGAGTCAATTCTTTATCAGCCTTGACCGT
TGTGATTGGCTCGATAAGAAGAATACCATCTTTGGGAAGGTCACTGGCGATTCTATTTTC
AACCTTCTAGCCTTGGCTGATATCGAGACTGATAAGGATGATCGACCTGTGTATCCGCAG
AAAATTCTTTCAGTTGAGGTACTCTGGAACCCATTTGATGATATTGTTCCAAGGCAACTT
AAGAAGACTGAGCCTACTGCCAAGGGTGATATCGAGGGGAAATCAAAGAAGAAAGCCGTT
AAGCAACTTAATGTGCTTTCATTTGGAGATGAAGTAGAAGAGGAGGAGAATGAGGCAGCA
TCCTCTGTGAAGGACAAAATAAAAAGTATTCACGATGTGTTGGATGATCCTCGGTTTCTT
AAAGGAGAGGCACCGGATGAGCAACTGACCAAGGAGCAAGAGGACAAAAAAAAGGAGACT
GTTCAATCTGTCAGGGAGGCTTTAGTATCAAAAAAATCTGACTTCAGAGAGCTAGAGCAT
GATTCAGAAACAGATGATTATCCTGACGATGAAAACGAGGAGGATTTTGATAACAGAATG
CGCTCTCAAATTCTAAGAAAACGCAGGGAGCTTGGGGACATCCGCTCTAGTGAAACCTCC
AAAAAAACAGATAAAGCACACCGTAAAGACAAGGAGTTACCAGTTCACAGGAGTGACGAT
GACAATGATGACGACAATGAAGACCACCAGCTAACCAAGTCTAGAAAATTTTCTATGAAG
AAAAAAGGCATTGGCTCAGAAGCCAGTGCTGAAAGGATGTCCAAAGGCGATGCTAATTTG
CAGCTATTGAATCCAGCTGAGCAAGAGAAGCATTTGCAAAAACAGAAAAGGCGCCGTCTT
CAAGGCCGTGAAGATGAGACGTTAGCGAAGCTACAGAAGTTCAAGGCATCGTTTCTCAGT
AAGAACCCTGCAACTGGTAACACAGAAAAGAAGACTGATGAAGAGGATTACACAGGGTGG
CACAGCAACCGGCTGACTTTTGAACCTGATTCTTCTAAGGATGGAATGACGAGGAAAGAT
GATCCAGATGACTATGTAGTGGTTGATCCTCTCCTTGAGAAAGGAAAACAAAAATTCAAC
AAGATGCAAGCAAAGCTTAAGCGGAGAGAACGTGAATGGGCAGGCAGATCTCTGACCTGA

Protein

500 aa

>Os01t0582400-01 Similar to Multidomain cyclophilin type peptidyl-prolyl cis-trans isomerase.
MSSVYVLEPPTKGKVVVQTTAGPLDIELWPKEAPKAVRNFVQLCLEGYYDGTLFHRVIKS
FLVQGGDPTGSGTGGESIYGAPFADEFHTRLRFNHRGLVACANAGTPHSNGSQFFISLDR
CDWLDKKNTIFGKVTGDSIFNLLALADIETDKDDRPVYPQKILSVEVLWNPFDDIVPRQL
KKTEPTAKGDIEGKSKKKAVKQLNVLSFGDEVEEEENEAASSVKDKIKSIHDVLDDPRFL
KGEAPDEQLTKEQEDKKKETVQSVREALVSKKSDFRELEHDSETDDYPDDENEEDFDNRM
RSQILRKRRELGDIRSSETSKKTDKAHRKDKELPVHRSDDDNDDDNEDHQLTKSRKFSMK
KKGIGSEASAERMSKGDANLQLLNPAEQEKHLQKQKRRRLQGREDETLAKLQKFKASFLS
KNPATGNTEKKTDEEDYTGWHSNRLTFEPDSSKDGMTRKDDPDDYVVVDPLLEKGKQKFN
KMQAKLKRREREWAGRSLT*

5'UTR

chr01:22596058..22596164 (- strand) : 107 bp

CDS

chr01:22595838..22596057 (- strand) : 220 bp

chr01:22595396..22595574 (- strand) : 179 bp

chr01:22595188..22595286 (- strand) : 99 bp

chr01:22594943..22595046 (- strand) : 104 bp

chr01:22594716..22594860 (- strand) : 145 bp

chr01:22593315..22593537 (- strand) : 223 bp

chr01:22593089..22593128 (- strand) : 40 bp

chr01:22592326..22592533 (- strand) : 208 bp

chr01:22592016..22592156 (- strand) : 141 bp

chr01:22591771..22591911 (- strand) : 141 bp

3'UTR

chr01:22591434..22591770 (- strand) : 337 bp

FASTA

>Os01t0582400-01 class=Sequence position=chr01:22591434..22596164 (- strand)
GACGACCATA CGAACCCGAG CACCCGAGCC ATCCCGACCG GCCGGAGAGC GAGCCCTAGG GCAGAGCGGC GGAGGCGGAG
GCCGGAGGCG AACGGGAGGC CGGCGAGATG TCGTCGGTGT ACGTGCTGGA GCCGCCGACG AAGGGCAAGG TGGTAGTGCA
GACGACGGCC GGCCCGCTCG ACATCGAGCT GTGGCCGAAG GAGGCCCCCA AGGCGGTGCG CAACTTCGTG CAGCTCTGCC
TCGAGGGCTA CTACGACGGC ACGCTCTTCC ACCGCGTCAT CAAGTCCTTC CTCGTCCAGG GCGGCGACCC CACCGGCTCC
GGCACCGGTG AGATCCCCAA ATCCTTCGCC TATCTGTATC TAGGGTTTGT GATTCCAGAC TGTACTGTTT GTTGGCCTGA
TTAGGTTGCT GGGGGGGGGG GGGGGGTTGG ATCGAATTGC TGAACAGTGA CCGAAAAGCT AGTAGGATAT ATGCTGCCTG
GTTAACAATT TGATTGTGTT AATTTGTTGG GTATGTGAGC CATAGTGTAA TTGGGGAGTT GTATAATGCT TTTGAATTGA
AGGTGATATG TGTCTAATTG CTATATGCAG GGGGTGAGAG CATATATGGG GCCCCATTTG CAGATGAGTT CCATACGCGC
TTGAGGTTTA ACCACAGGGG TTTAGTGGCG TGTGCCAATG CCGGCACGCC TCACTCGAAT GGGAGTCAAT TCTTTATCAG
CCTTGACCGT TGTGATTGGC TCGATAAGAA GAATACCATC TTTGGGAAGG TACTGTGTTT GGCTTGATTA TTGATCTCAG
GGCGGTATTT GGTGCTATGC ATTTGTCTCA TTTAGGGTGA TTATGGTTGC TTATTATGAT GTTGTATGCT GTATGCAGGT
CACTGGCGAT TCTATTTTCA ACCTTCTAGC CTTGGCTGAT ATCGAGACTG ATAAGGATGA TCGACCTGTG TATCCGCAGA
AAATTCTTTC AGTTGAGGTT GTCTTTTGTT CTCTCGTTTT TGGTGCACTT CCACTTTGTT TTGGTACTTA CAATTTGATG
ATATAGTACC TTCTAAAAAC TATTTATGGT GAAGCCAACT TATTTAATGG TTAGCTACGT ATGCTTCTAA TTCTGAAGGT
ACTCTGGAAC CCATTTGATG ATATTGTTCC AAGGCAACTT AAGAAGACTG AGCCTACTGC CAAGGGTGAT ATCGAGGGGA
AATCAAAGAA GAAAGCCGTT AAGTAAGTTG TCTGCCACTT CATGTTGCCC TTGAAAAGAT AGGGAGATGT GCGTTTGTTT
TGACTTGTTT TATTCATCAT ACAGGCAACT TAATGTGCTT TCATTTGGAG ATGAAGTAGA AGAGGAGGAG AATGAGGCAG
CATCCTCTGT GAAGGACAAA ATAAAAAGTA TTCACGATGT GTTGGATGAT CCTCGGTTTC TTAAAGGAGA GGCACCGGAT
GAGCAACTGG TGAGTAATAT CATTTGTAGT TAGATAAGCC TTTAAAACTG GCAACTGGCC AGTGAACACA CTCACAGTAA
CAATAACAGG ACAAAACAAA CTCTGCAGTA ACGCTGCTGT TTCAGCACCT TACAGTATGA AATCAGGACT TGATGTGCTG
TTTTTTCTAC TTTACCAAGG AAGGTGGTTC ATTTGAGCTG TTTATGTAGG TTATGTGTTT TCAGTTTTCA CTAGTCCATA
ATACTTCATA GCCAAGTATC TAGCTACAAG ACATTGAGTC AAAAAAGTAT TTTTTTTAAT AAATATTTCA TACTAGGCCT
CCTTTTGAAC ACATGATTTT TTTCCTGGTT CCTGAGAGAA CTGAACCGCT TCCTAGAAAT TCCTTTGTTA CAAAGGAGGT
CCTAGTTTAT TTTCCAGGAA ACATGTACTA TGAACTCAGG ACCACTCTGT ACTTAGTACT AATCAGAATA CTCTCATTTA
TGATCTGATT TCCTGTTATA TGTTGTTCTT CAGTCATGCA CAATCTGTCT TTTGTTACTT TAGGGCATAA ACTGTTACTC
TGCTATGGTT TTGCAATTAC TGTGCCACCT TTAGATCAGA TTAAGAGTTA ACTTGTTAAG AGACATTACA GAGGAATGTC
ATCTTGGAAC CATTACAATG GTCTCATTTA GAAAAATGCT ATCGCGAACA TGAAATATTC TGATAATTAT CATTACCATC
ACATTTTCCA TCCCATGGGT ATGAAATGCC CATTCCCCCC TTCCCCCACA CTTTTTACTT TCATTTTCTT TTCTTTTGTT
GTTACTTAGG CAGTTTCACC TGTTATAACA TACCAAAACT TGGAAGCATT TTTAAAAATC AGATTAAACA TTTAATTTTC
AAGCGAACAA TTCTTTATGC AGATTTAATA AAGTATTTCT AATCCATGTA ATTATCAAGT TCAAAATCTA TTTTGCCTCC
TTTCGAATTC TCTCACCAAA ATAGATGTTA AGTGGATGGG AAATGTTGCA GCAGTAGTAT TCCCCAGAAT TTTTCATGTC
TGATGATGGC ATTTTACTAC AGAAGACCTT TTGGATGGTA TTTTTTTGCG TTCCTTTACG ATGGCATTGG ACATATTTAC
TTTATTATGA ATTAGTTTTA GTTCCTCTTA AATGTAAAAA GTCATTATGC TTATTCCAAT CTTGCAGACC AAGGAGCAAG
AGGACAAAAA AAAGGAGACT GTTCAATCTG TCAGGGAGGC TTTAGTATCA AAAAAATCTG ACTTCAGAGA GCTAGAGCAT
GATTCAGAAA CAGATGATTA TCCTGACGAT GAAAACGAGG AGGATTTTGA TAACAGAATG CGCTCTCAAA TTCTAAGAAA
ACGCAGGGAG CTTGGGGACA TCCGCTCTAG TGAAACCTCC AAAAAAACAG GTAAATTATC TTCCTGTTTA TATTAGAAAC
ATCAATATCC AACTGTTGAA CAATTTGATA GTAGTGTAAC AGTTTTAGCA GGTAGTGTGC TTCTGCAATT TCCTGCCAAT
GTTTGCAATT TTTTAATACT TACGGAATTA TGATTGCTAA ATATTGTTTA ATACTTTGTT TTGTTGCTTG GTACAGATAA
AGCACACCGT AAAGACAAGG AGTTACCAGT TCACAGGTTC ATATCTACCA TATCTCTGTA TAACCTTATC TGTACCATAC
CTTTGAAATA GCTGTGTAAT GTTGAAAAGG TTGTTTATTT CAAAGCCTCA TTATTATGTA ATATTGAACA ACGGTGAACT
GTACTTTTGC GATAGTTGAA AGAGGGGAGG AGGGGGATAA ATCGGATTTG ACCCTATTGA ACAACTATAA TATACCCCTT
CTCGACTTCA CTACTTAGCA TGCAATCCTG CAGCCCCCTG AAATACCTCT CTCTTATACA ATATTATATG ATTATGTTCT
GAAATGTCAT GGTACAGTAT TTACATTTAG TTATTGGCAA ACTAATATTC AGGGTCAAGA ATCTGTCTGA AACTCCAAAT
GGACTATCTT TCCAAACCAG AATCAATCTT AAAAGAAATG GTCTATTTCA ATCTTAAAAG ATTTGGTTTA TTTCTGTTCA
TCCTTTAACC GTAACGTTGT TCAGAATCAG TGGACCATGC TGTACTGGAC TTCTGAACTT CATTTTATTC CAATGGTTTT
AGTAAATTTG TTACCTATCT GATGTTTGCA GGAGTGACGA TGACAATGAT GACGACAATG AAGACCACCA GCTAACCAAG
TCTAGAAAAT TTTCTATGAA GAAAAAAGGC ATTGGCTCAG AAGCCAGTGC TGAAAGGATG TCCAAAGGCG ATGCTAATTT
GCAGCTATTG AATCCAGCTG AGCAAGAGAA GCATTTGCAA AAACAGAAAA GGCGCCGTCT TCAAGGCCGT GAAGATGAGG
TAGTGATTTT TTTTTGCTTG TTTGCAATTT CAACATTTTT ATCCCATGCC AAGATGTTCA TGCCTATTCA TATAATCATA
TTCCAATTAG CATCACATCT ACTTCTTAGC TTCTATGTTC TCTAAGTTGA GCTGTGAAAT GTTTCTTACC TGTTGTTTTT
CTTGTTAGAC GTTAGCGAAG CTACAGAAGT TCAAGGCATC GTTTCTCAGT AAGAACCCTG CAACTGGTAA CACAGAAAAG
AAGACTGATG AAGAGGATTA CACAGGGTGG CACAGCAACC GGCTGACTTT TGAACCTGAT TCTTCTAAGG TATGCTACCA
CACCCTCTAC TTTTCTTGCT CATCTTTTTC AGCACACAAG TGGCAAATAG ATTCATTATG TGCAGTGCCT GAGTTGTTAT
CTGATATTTA CAGGATGGAA TGACGAGGAA AGATGATCCA GATGACTATG TAGTGGTTGA TCCTCTCCTT GAGAAAGGAA
AACAAAAATT CAACAAGATG CAAGCAAAGC TTAAGCGGAG AGAACGTGAA TGGGCAGGCA GATCTCTGAC CTGACCGCAT
AAGCTGCTTG AGGTGCTTTA CTGTTTCCTT CATAAGCGGC CTTCCTGAAT TTTTCAGCTT ACATTAATTT ATCCTTTTTT
TGCCTCTCAG AGGTGCACCG TGCAAAAGAT TACCTCATAT CATAACAGTG CCACTACTGC AGTTTTGATG GTGTTGTAAC
TGTACACTGC GTTTCGCTAT GTTGTGGTTC ATGGTAGAGG GACCACCTGT AGACTAGTGC TTTTAACATT AACATTTGTA
TCATTGTCAA TCAAACTGTA AATAACAATT GTTTTAAACT TAGAGGTTCA TAATGCCCTT ATTAAGTTGC AGTGGTCTTT
TTTTTTATTG G

Locus: Os01g0582400

Loading...

Locus: Os01g0582400

Loading...