Os01t0586800-00

Locus

Os01g0586800

Description

Similar to WRKY transcription factor 5 (Fragment).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

WRKY27

CGSNL Gene Name

RICE WRKY GENE27

Oryzabase Gene Symbol Synonym(s)

OsWRKY27

Oryzabase Gene Name Synonym(s)

Rice WRKY gene27

Transcript Evidence

BT037307 (DDBJ)

Protein Evidence

Q09I59 (UniProt)

Literature

Rice WRKY Working Group 2012. Rice 5:3.

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: sequence-specific DNA binding transcription factor activity (GO:0003700)

Molecular Function: sequence-specific DNA binding (GO:0043565)

Functional domain (InterPro)

DNA-binding WRKY (IPR003657)

Expression Databases

TENOR (Os01t0586800-00)

Others

Oryzabase (6539)

Transcript

707 bp

>Os01t0586800-00 Similar to WRKY transcription factor 5 (Fragment).
GCGGACGCCGGCAACGGCGGCGGCGACGGGTACCTCGCCCTCGCGCTGCGTTGCGCCCCC
GCCGCCGGCGAGCCAATGGTGCATCCCAAGAGGCAGAGGGCCACCACCAACAGCAGCAGT
AGCAGCAGCATCTGCGGCGAATACGGGGGCGGCGCCGCCGCCGCCGCCGTGCCGGCGGGC
CACGACGACGACGACCGGTCTTGCATGATCACGGCTGCGACGGTTGTCAATGGCGCAAGT
ACGGGCAGAAGACGGCGAAGGGCAACCCGTGGCCGCggggctactaccggtgcaccggcg
cgccggggtgccccgtgaagaagcaggtgcagcgctgcaaccacgacacctccgtcctcg
tcaccacctacgatggcgtccacaaccacCCCATCACGCCCTACGCCGCCGCGCTCCCTC
CGTCGTCGTCGTCCTCCTCATCGGCGGCGGTAGCCATGCTCGCCTCCTCCTCGTCGTCTT
CGACGTGGTCGGAGCTTCAGCGCGCGATGCCGGCGGCGCAGTCGTCATGGAGCCAGAGAA
ACTACCCTATTCAGGCAGATGTCGTGGCGAAGGCGATCTGGGACCCCAAGTTCCAGGCGA
CGGTGGCGGCCGCCGTCGCGAGCTACGTCCGTGACCGTGAGCAGAGCGCGCGCGTTGCCG
GTGGGAAGGGTGCCGGAGAGCTCTTCAACTTGGCTCCTCCATGCTGA

CDS

585 bp

>Os01t0586800-00 Similar to WRKY transcription factor 5 (Fragment).
CAGCAGCATCTGCGGCGAATACGGGGGCGGCGCCGCCGCCGCCGCCGTGCCGGCGGGCCA
CGACGACGACGACCGGTCTTGCATGATCACGGCTGCGACGGTTGTCAATGGCGCAAGTAC
GGGCAGAAGACGGCGAAGGGCAACCCGTGGCCGCggggctactaccggtgcaccggcgcg
ccggggtgccccgtgaagaagcaggtgcagcgctgcaaccacgacacctccgtcctcgtc
accacctacgatggcgtccacaaccacCCCATCACGCCCTACGCCGCCGCGCTCCCTCCG
TCGTCGTCGTCCTCCTCATCGGCGGCGGTAGCCATGCTCGCCTCCTCCTCGTCGTCTTCG
ACGTGGTCGGAGCTTCAGCGCGCGATGCCGGCGGCGCAGTCGTCATGGAGCCAGAGAAAC
TACCCTATTCAGGCAGATGTCGTGGCGAAGGCGATCTGGGACCCCAAGTTCCAGGCGACG
GTGGCGGCCGCCGTCGCGAGCTACGTCCGTGACCGTGAGCAGAGCGCGCGCGTTGCCGGT
GGGAAGGGTGCCGGAGAGCTCTTCAACTTGGCTCCTCCATGCTGA

Protein

195 aa

>Os01t0586800-00 Similar to WRKY transcription factor 5 (Fragment).
QQHLRRIRGRRRRRRRAGGPRRRRPVLHDHGCDGCQWRKYGQKTAKGNPWPRGYYRCTGA
PGCPVKKQVQRCNHDTSVLVTTYDGVHNHPITPYAAALPPSSSSSSSAAVAMLASSSSSS
TWSELQRAMPAAQSSWSQRNYPIQADVVAKAIWDPKFQATVAAAVASYVRDREQSARVAG
GKGAGELFNLAPPC*

5'UTR

chr01:22826156..22826277 (- strand) : 122 bp

CDS

chr01:22826060..22826155 (- strand) : 96 bp

chr01:22824809..22825297 (- strand) : 489 bp

FASTA

>Os01t0586800-00 class=Sequence position=chr01:22824809..22826277 (- strand)
GCGGACGCCG GCAACGGCGG CGGCGACGGG TACCTCGCCC TCGCGCTGCG TTGCGCCCCC GCCGCCGGCG AGCCAATGGT
GCATCCCAAG AGGCAGAGGG CCACCACCAA CAGCAGCAGT AGCAGCAGCA TCTGCGGCGA ATACGGGGGC GGCGCCGCCG
CCGCCGCCGT GCCGGCGGGC CACGACGACG ACGACCGGTC TTGCATGATC ACGGCTGCGT CGACGGCGAA TCGGCCTGGC
CGGGTCGTAC TCAGAACACG ATGCAGCGCA CCCACGGTAC GCACGTAGCA CACGCATATA GATAGTGACC AATTAATATA
tttcatatta taagttttct cagtcaaagt ttttctgttt gaacaaatta aatttataga gaaaattagt aaaatttaca
acaccaagtt agtttcatta aatttaacat tgcatatatt ttgatgatat tcttattttg tattgaaaat gttaatatat
ttttctataa acttagtcaa acttaaagaa ctttgactaa gaaaaaaatc aaacgactta taatataaaa tgaaagaagt
aTTGTATAAG TTGAGACATA TATGCACGCT TCATTATTGT ATATTCCCTC TTTTTTTTAA AAAAAGAAAT ACATACGTCA
CCATTAACTT GAGACATAAT ATACAGCCTT ATGTAAAAAA AATTATGCAA Atactccctc catcccaaaa tgtttgacgc
cgttgacttt tttaaaaatg tttgaccgtt cgtcttattc aaaaatttta agtaattatt atttttttcc tatcatttga
tttattctta aatatatttt tatgtataca tatagtttta cacatttcat aaaagttttt gaataagacg aacggtcaaa
tatgtttaaa aaagtcaacg gcgtcagaca tttagagaag gagggagtaC AATGGTATAG ATGAGCTGAT TTATTTTTGA
ATTTTATCTC ACAGGTGAAG GACGGTTGTC AATGGCGCAA GTACGGGCAG AAGACGGCGA AGGGCAACCC GTGGCCGCgg
ggctactacc ggtgcaccgg cgcgccgggg tgccccgtga agaagcaggt gcagcgctgc aaccacgaca cctccgtcct
cgtcaccacc tacgatggcg tccacaacca cCCCATCACG CCCTACGCCG CCGCGCTCCC TCCGTCGTCG TCGTCCTCCT
CATCGGCGGC GGTAGCCATG CTCGCCTCCT CCTCGTCGTC TTCGACGTGG TCGGAGCTTC AGCGCGCGAT GCCGGCGGCG
CAGTCGTCAT GGAGCCAGAG AAACTACCCT ATTCAGGCAG ATGTCGTGGC GAAGGCGATC TGGGACCCCA AGTTCCAGGC
GACGGTGGCG GCCGCCGTCG CGAGCTACGT CCGTGACCGT GAGCAGAGCG CGCGCGTTGC CGGTGGGAAG GGTGCCGGAG
AGCTCTTCAA CTTGGCTCCT CCATGCTGA

Locus: Os01g0586800

Loading...

Locus: Os01g0586800

Loading...