Os01t0591000-01

Locus

Os01g0591000

Description

Aldehyde/histidinol dehydrogenase domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ALDH1A

CGSNL Gene Name

ALDEHYDE DEHYDROGENASE 1A

Oryzabase Gene Symbol Synonym(s)

ALDH1a, Aldh1a, OsALDH1a, OsALDH2C4, ALDH2C4

Oryzabase Gene Name Synonym(s)

aldehyde dehydrogenase 1a, aldehyde dehydrogenase 2C4

Transcript Evidence

AK119571 (DDBJ, Best hit)

Protein Evidence

A4UUE0 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: metabolic process (GO:0008152)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: oxidoreductase activity (GO:0016491)

Molecular Function: oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor (GO:0016620)

Functional domain (InterPro)

Aldehyde dehydrogenase domain (IPR015590)

Aldehyde dehydrogenase, conserved site (IPR016160)

Aldehyde/histidinol dehydrogenase (IPR016161)

Aldehyde dehydrogenase, N-terminal (IPR016162)

Aldehyde dehydrogenase, C-terminal (IPR016163)

Full-length cDNA

002-117-A10 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0591000-01)

RiceXPro (AK119571)

Others

Oryzabase (20179)

KEGG (Os01t0591000-01 (EC:1.2.1.3))

Transcript

1854 bp

>Os01t0591000-01 Aldehyde/histidinol dehydrogenase domain containing protein.
ATCCCTCCCTTTAAAAAAGGGCGCATCATCTCTAAACTCCCCTCCACATCTCCAAACTTC
CAATTTCTCTCTCCACATCTCTCTGTGTTTCTTTTATTTCTCCTCTGCTCGCGGCGATGG
CGGCGGCGAACGGCGGCGACAGCAAGGGGTTCGAGGTGCCGAAGCTGGAGATCAAGTTCA
CCAAGCTCTTCATCAATGGCCGCTTCGTCGACGCCGTCTCCGGCAAGACATTCGAAACCC
GTGACCCGCGCACCGGCGAGGTCATCGCCAAGATCGCCGAAGGAGACAAGGCCGACATCG
ACCTCGCCGTGAAGGCCGCCAGGGAGGCCTTCGACCATGGCCCCTGGCCAAGAATGTCCG
GCTTTGCGAGGGGAAGGATCCTGCACAAGTTCGCGGACCTGGTGGAGCAGCACGTGGAGG
AGCTGGCGGCGCTGGACACGGTGGACGCCGGCAAGCTGTTCGCGATGGGGAAGCTCGTCG
ACATCCCCGGCGGCGCGAACCTGCTCCGGTACTACGCCGGCGCGGCGGACAAGGTGCACG
GCGAGACGCTCAAGATGGCGCGGCCATGCCACGGGTACACGCTCAAGGAGCCCGTCGGCG
TCGTCGGCCACATCGTGCCGTGGAACTACCCCACCACCATGTTCTTCTTCAAGGCCagcc
cggcgctcgccgccggctgcaccatggtcgtcaagcccgccgagcagacccccctctccg
cgcTCTTCTACGCCCACCTCGCCAAGCTTGCCGGCGTCCCCGACGGCGTGCTCAACGTCG
TCCCCGGCTTCGGCCCCACCGCCGGCGCCGCTATCTCCTCCCACATGGACATTGACAAGG
TGAGCTTCACCGGCTCGACGGAGGTCGGCCGGCTGGTGATGGAGGCGGCGGCGAAGAGCA
ACCTGAAGCCCGTCTCGCTCGAGCTGGGTGGCAAGTCTCCGGTCATCGTGTTCGACGACG
CCGACCTCGACACGGCCGTGAACCTGGTCCACATGGCCTCCTACACCAACAAGGGTGAGA
TCTGCGTCGCCGGCTCGCGAATCTATGTCCAGGAGGGGATCTACGATGCGTTCGTGAAGA
AGGCGACCGAGATGGCCAAGAAATCGGTGGTCGGAGATCCGTTCAACCCGCGAGTTCATC
AAGGCCCTCAGATTGACAAGGAGCAATACGAGAAGATCCTCAAGTACATCGACATCGGTA
AGCGCGAAGGCGCGACGTTGGTCACCGGAGGGAAGCCCTGCGGCGAAAACGGGTACTACA
TCGAGCCCACCATCTTCACGGACGTCAAGGAAGAAATGTCGATCGCGCAAGAGGAAATCT
TCGGGCCGGTGATGGCCCTCATGAAATTCAAGACGGTTGAGGAGGCGATCCAGAAGGCGA
ACAGCACCCGGTACGGCCTGGCTGCCGGCATAGTCACCAAGAACATCGACGTCGCGAACA
CGGTTTCGCGGTCGATCCGGGCAGGGGCAATCTGGATCAATTGCTACCTCGGCTTCGACC
CCGACGTGCCGTTCGGGGGGTACAAGATGAGCGGCTTCGGCAAGGACATGGGCATGGACG
CCCTTGAGAAGTACCTCCACACCAAGGCGGTGGTCACCCCTCTCTACAACACCCCTTGGC
TATGATCTGATGATGAACAGCACAGAAAGATTAATTACAGTGGAAAAAAATAACATTTCT
ATATATACAGCTGAAAGGTTGGGTTATATTTGTGGTTAGTTGATTGCTTGTATCAAATAT
CAATTTGTCGGAATAAAGACAGTATATTTCAGTTTCTCGGTGTGTTTTTCTTTGTCTGAT
GATCTGACGTAAACCCATAAGAAAAAGGTTAATGACAGTATACTATCAAACGCT

CDS

1509 bp

>Os01t0591000-01 Aldehyde/histidinol dehydrogenase domain containing protein.
ATGGCGGCGGCGAACGGCGGCGACAGCAAGGGGTTCGAGGTGCCGAAGCTGGAGATCAAG
TTCACCAAGCTCTTCATCAATGGCCGCTTCGTCGACGCCGTCTCCGGCAAGACATTCGAA
ACCCGTGACCCGCGCACCGGCGAGGTCATCGCCAAGATCGCCGAAGGAGACAAGGCCGAC
ATCGACCTCGCCGTGAAGGCCGCCAGGGAGGCCTTCGACCATGGCCCCTGGCCAAGAATG
TCCGGCTTTGCGAGGGGAAGGATCCTGCACAAGTTCGCGGACCTGGTGGAGCAGCACGTG
GAGGAGCTGGCGGCGCTGGACACGGTGGACGCCGGCAAGCTGTTCGCGATGGGGAAGCTC
GTCGACATCCCCGGCGGCGCGAACCTGCTCCGGTACTACGCCGGCGCGGCGGACAAGGTG
CACGGCGAGACGCTCAAGATGGCGCGGCCATGCCACGGGTACACGCTCAAGGAGCCCGTC
GGCGTCGTCGGCCACATCGTGCCGTGGAACTACCCCACCACCATGTTCTTCTTCAAGGCC
agcccggcgctcgccgccggctgcaccatggtcgtcaagcccgccgagcagacccccctc
tccgcgcTCTTCTACGCCCACCTCGCCAAGCTTGCCGGCGTCCCCGACGGCGTGCTCAAC
GTCGTCCCCGGCTTCGGCCCCACCGCCGGCGCCGCTATCTCCTCCCACATGGACATTGAC
AAGGTGAGCTTCACCGGCTCGACGGAGGTCGGCCGGCTGGTGATGGAGGCGGCGGCGAAG
AGCAACCTGAAGCCCGTCTCGCTCGAGCTGGGTGGCAAGTCTCCGGTCATCGTGTTCGAC
GACGCCGACCTCGACACGGCCGTGAACCTGGTCCACATGGCCTCCTACACCAACAAGGGT
GAGATCTGCGTCGCCGGCTCGCGAATCTATGTCCAGGAGGGGATCTACGATGCGTTCGTG
AAGAAGGCGACCGAGATGGCCAAGAAATCGGTGGTCGGAGATCCGTTCAACCCGCGAGTT
CATCAAGGCCCTCAGATTGACAAGGAGCAATACGAGAAGATCCTCAAGTACATCGACATC
GGTAAGCGCGAAGGCGCGACGTTGGTCACCGGAGGGAAGCCCTGCGGCGAAAACGGGTAC
TACATCGAGCCCACCATCTTCACGGACGTCAAGGAAGAAATGTCGATCGCGCAAGAGGAA
ATCTTCGGGCCGGTGATGGCCCTCATGAAATTCAAGACGGTTGAGGAGGCGATCCAGAAG
GCGAACAGCACCCGGTACGGCCTGGCTGCCGGCATAGTCACCAAGAACATCGACGTCGCG
AACACGGTTTCGCGGTCGATCCGGGCAGGGGCAATCTGGATCAATTGCTACCTCGGCTTC
GACCCCGACGTGCCGTTCGGGGGGTACAAGATGAGCGGCTTCGGCAAGGACATGGGCATG
GACGCCCTTGAGAAGTACCTCCACACCAAGGCGGTGGTCACCCCTCTCTACAACACCCCT
TGGCTATGA

Protein

503 aa

>Os01t0591000-01 Aldehyde/histidinol dehydrogenase domain containing protein.
MAAANGGDSKGFEVPKLEIKFTKLFINGRFVDAVSGKTFETRDPRTGEVIAKIAEGDKAD
IDLAVKAAREAFDHGPWPRMSGFARGRILHKFADLVEQHVEELAALDTVDAGKLFAMGKL
VDIPGGANLLRYYAGAADKVHGETLKMARPCHGYTLKEPVGVVGHIVPWNYPTTMFFFKA
SPALAAGCTMVVKPAEQTPLSALFYAHLAKLAGVPDGVLNVVPGFGPTAGAAISSHMDID
KVSFTGSTEVGRLVMEAAAKSNLKPVSLELGGKSPVIVFDDADLDTAVNLVHMASYTNKG
EICVAGSRIYVQEGIYDAFVKKATEMAKKSVVGDPFNPRVHQGPQIDKEQYEKILKYIDI
GKREGATLVTGGKPCGENGYYIEPTIFTDVKEEMSIAQEEIFGPVMALMKFKTVEEAIQK
ANSTRYGLAAGIVTKNIDVANTVSRSIRAGAIWINCYLGFDPDVPFGGYKMSGFGKDMGM
DALEKYLHTKAVVTPLYNTPWL*

5'UTR

chr01:23097292..23097407 (+ strand) : 116 bp

CDS

chr01:23097408..23097513 (+ strand) : 106 bp

chr01:23103831..23103973 (+ strand) : 143 bp

chr01:23104135..23104608 (+ strand) : 474 bp

chr01:23104839..23105012 (+ strand) : 174 bp

chr01:23105119..23105256 (+ strand) : 138 bp

chr01:23105378..23105513 (+ strand) : 136 bp

chr01:23105638..23105701 (+ strand) : 64 bp

chr01:23105799..23106072 (+ strand) : 274 bp

3'UTR

chr01:23106073..23106301 (+ strand) : 229 bp

FASTA

>Os01t0591000-01 class=Sequence position=chr01:23097292..23106301 (+ strand)
ATCCCTCCCT TTAAAAAAGG GCGCATCATC TCTAAACTCC CCTCCACATC TCCAAACTTC CAATTTCTCT CTCCACATCT
CTCTGTGTTT CTTTTATTTC TCCTCTGCTC GCGGCGATGG CGGCGGCGAA CGGCGGCGAC AGCAAGGGGT TCGAGGTGCC
GAAGCTGGAG ATCAAGTTCA CCAAGCTCTT CATCAATGGC CGCTTCGTCG ACGCCGTCTC CGGTACGTCG CTGCGTGCTT
CCTAATTAAT CCTCCCTCTT GCATCTTTCA CCTTTTTTTT AATTATTATT CTTCTCCTGA TGCTTTTTTT GACTCACGAA
AGTTAGCAAC AAGAAGCATC TGTTAGTACT TCTGTTTCTT TATTGTTTGC AACTTTCTTT TTTtactatc tccgtttcgt
attagaaatt aacataaact tctttaagtt taacaatttt tttaaagaaa tagcaacatt tagaacacaa aacaaacgca
atattaaaat atattaaata ttggtttaga tgaaactaat ttagcgttgt aaacgttgct aatattttta ataaacctga
acaaactcaa aagtttgatt agaaaaaaaa tcaaaacgaA AACAGAGACG GATATAGAGT ATTGATTAGT CACAATACGT
GCGACACCCT GCGCTTTTAA CACCAAGTTA GATAAATGTG ATAGCCGAGT AGTATCTATA GCGTGTTAAG AAGTGCGGGA
CGTCATAGTA CGCAAGTGAG GGTGATTTAT CGTGTAAAAA AGATAGAAGA AACCGAATGT GAGGATGAGA CAATGGTAGT
ATGGTATCTA GATTTAAGCA TTGCTTCGGA GAATTTGTTT ACTGAATGAA TGCATGAGTT TCACCGAATT TTCGAATAAA
TAGGTATAAT TCCTGTAAAG TTCATTAAAA AAAAACCTCT ATTCCAAAAG AGGCTTAAAA TATTACTACC AAATATGCAT
ATTTAAATGC ATGTTGCATG GTCCACCCTG TTCCATGTGG AGGTAAATCA AATGAGGCCT AATATATTAA TTACTACTAC
TGGACAACTT GCTAGTTATG GGGCTTAGCT AGGGATCAAG TCAAATATTC CAGGATTGTG CCAATGCTGA AGACAACTTT
GGACACGGGC ATCTTTGGGA TATATCAAAA AAATTAACTG ATATTGGTTG TTTGATTGTG TGGTTGTGAG AAACAAGAGC
TAAACCTGCT TACATGTTAG GTACTTCCAA ACAGAAGTTG TGCCATGCCA TCACTCTATA TTTTTTTCGT TTTGAAAGAT
CCATCACTGA TCAAAACAGC AGAAATTATG GAAGCCTCTT TTTGACCAAG ATCTAGCTTT TTTAAACAAA CGCAAGAAGA
TGATCAAACA CACCACACAC ATTTCTACAT ACATCTCATC ACCAAAGATC TTGAGCGGAT GGGTACGTAT AGAACACGTC
ATCAACCCCC CCCCCCCCCC CCAAACATCT CACTTTCAAG AAGATATTGC TCGAGAGAAA CACACGTCAT GGAGAGCTGA
AAGTGGATGT ACTTCCAAGA GAGCGAGAAC ACTACAGCTG CATATTGCGT GTGAAAGACT GAAAATCTGA AACTGTAGAG
CCTGAAGAAG GGGGGAAAAG AAAAACAGAG TGTCGACTCC GTGTGAAACT CTGAACTGAA GTTATTTTTT TTTTCGCCGG
GAAGGCCGAA GGAGGCCAAC CGAgtatatt aagaaggaat aaaagttaca agagaaaaaa catcaaaata caccaaggtg
cattgccaca caccacacgc taccacccaa gcacaaaccg ctgagggtga aacctagcac caaacgaccc ccgctaggcc
tacggcaaca ccacagagac gaggctccga aaacgatgcc accatggtgg tcacgacatc taggatgccg ccatcgccca
tctaaaaaga tctggttttc acccagagaa gctcgccaag aaagggggag ggtaaccctc gacaacgctc caaggagatt
acgacgtccg aagacgtagc cgctgccggt ccggtgaacc accggactag gctttcgcct gggaccctac aaccttgact
gcagatcgcc atccaccaac tcagaaccac cacacagaca aatggcagca cgtggcatcc accataccgc accgatgccc
ctccgtcggt cgacttcaac gaaccaccac ccctgaaagc tggcccagga ctcctccgtt ccaccacccg ccggccgcct
cgccagattt ggccgaagga gaacccggga ctaggtggca ttgcttcggc agcctgagct tcccccactg acgagctgcc
gcctcaatcc aacctagaaa ctccccgcaa agaaggggag gagctccatg aaggctgagg gtgccgaccg gcaacgagga
agacgaccca ccaccgccaa ctccctttgc tctgccatct ggccgccggt ggtgctgctg ctccagaccg gcaccacccg
ccggcgcccc cgaagtccag ccgtcgctcc tcccctagcc accgcgacgg catcccggct gcctggcccc cacgccgagc
cgcCACCGAG GCCTGGACGA CCCACCGCGC CATGGGCTGG CGCCGGGCGA CCAGGCCGAG CGAGTGAGCG GGGGTGCCCC
TGCCGCTCCG GGCAGGCTGC GCTGCCCGCC GCCTCCGCGA CCCGGCCGGC CACGACGAGC CGCGGCCATC CGCCGCccgc
gcctgccgct gacgagccgc ctccacgtcg agccgcagtc gtccgccgcc tccgcgcccg tgccgggccg gcctagccgc
agccggccgc cgcctcgccg ccttgccgcc ggccgccacc acgaccgcat gtcgtcgcgc cgccccaggc ctcctcgcgc
cgccgccgcg cagatccagg cgagggaggg ccggatccgg ccatgggggc tccggatccg ccgcctcctc ccctcctcgc
cgccgtagct gccatggacc acgccggcgg ggagcttcgt cgtcttcgac tcttcgtcct tcgcgcagag aagggagacg
ctacgaagag aagaaggcct cgccgccgcc ttccctgcct gctaccggct tcgccgccgg cgggctccag cggcggcgag
gtagggggag ggagggagag aaggcgcggg tggctagggt ttttgcgccc ccgagccgcc cgACACGAAA GCTATGCGCG
GGGGAGGGGG GGCTGAACTG AAGTTAGGAA ATTAACAACA Gagggtgtgt ttagttcacg ctaaaattag aagttttgtt
taaattgaaa cgatgtgacg aaaaatttga aagtttgtgt atgtaggaaa gttttgatgt gatgaaaaag ttaaaagttt
gaagaaaaag tttggaacta aactcggccA GAATTTCCAG GCGTCACTGC CTGTAGCTTT GTATTAAATT TTAGATGAAA
TCAATTCTTT TTTTTTCCTG GGAATGATGC GTGTGTCCAA GCTATAGCTT AATTAGCTAG TGGCGGTGAG CCTATGGAGC
GTTGCGAGAC AGGCATTGGC ACTGTGGGAA GAAAACGAAG GGTGGGAGAG AGCTTGAGAA GGACAGGCAG ATCCACACAG
ATGGCGAGAT GTATCCATAT GAATATGATA GTAATATGAT GAACTGTGTG GCAGCATTGC AAAATGCCAC ATGGTACCAT
GGAGTAATAT GCATCACTAG AGCTATATCA TGTGGCGCAT CAGTGTCCGG GAGAAAAGGC AGGGTAGTGG GACACATGGA
AAACGCGGTA ATTTTGACAG TAACATACTA CGGTTTTAGT CAGGTCAAGA GTTGACAGCA CGCAGCTTTA GTTAGAACTA
AGTACTctcc ctccgttctc gaataactga cacggttaac tatagaggtc tcactttgat tacaaattac ttttaaataa
ttatattatg aatttatgaa gtatattttc aagtgtttat taaatttctg taaaaggacg agcggtcaaa agtttaaaat
tatatagtgg cagcgtaaat tatttgagaA TGGGTGGATT ATTTTCTGGT CTCTATTGGT CGTAGTAGAA GCAATATGAG
CCGTTGATTT ACAAGGGTCT TATCCTATTT TACGGGACAG TTATACCAGG CAATGTCTAA GTTCAATGTA TGTGCAACGA
TCAGTGCACA TATATATACA CACACACGAG TGATGAATCC TGTTGACTGT TGAGACTGAG CTGTTCGGTA TCTAGCGTTT
TCAGGGGCTT AATTAGGTTT ATTTTTCATA AAGCATCCGT ACATTTTCTT TCTTTTCTTT TCTTTTCAAT AAATTAGACA
CGGCCGGGCC GTCCGACCCA ATAAGTCCAA GCATGCCACT ATCACTATGG CAGATAACAC TAGCTTGCAA CGTCGCTTAT
GCAGACGCCA ATAAAACTGG CATTGTTGTG CTAGCTTTTT TCTTAAAAAA AGGAAAATTG CATTGTTGTG CTAAGCTAGG
GGACGACGCC TGCAAATATT TCAATGCATT ATTGTGCTCT GATTGGGCTC AACACTCAAT TACGTGTTGC TTTTTTCTGA
ATATAAATTA TAGGAGTACA AATTAAGTAC ATATATATCT GATCACATAT TTCTCATATT TGGGTACTTC GACATTGACC
ATCCATCCTC CATAATAATA TTATTTTTCG TGCTAGCCAA GTACTGATTT GGATATATAA ATGATGAATA GGATGTTTTT
GAGCAGAATT CATTGCCTGG TAATATTTTG CAAGGAATTT AAAACATAGG CCTACTTTGA AATGGAGAAA TTTTAAAGAA
ATGTTGCGTA AATTAAATTA ACTTCTACGA AAAGCGTACA AAATTCTTTC GTTCGAAAAG AGCTGTTCAT CCCAGCGCGA
TTAGACTAGT TCGTACTACT AAAGGATGAA GTACTAGTAT GTAGTAGGTT GAAAGTGCTT TGAAATTCAA TGTCTTTATT
AGTATTTATT TTTATCTCGC AAGACATACG TGTACACAAT ATTATGATAT CTCTAGAGTA ATAGGCTCAA ATGTAAAAAA
GTTCACGTGT TAATTAATTA GCAATAAGAA AAATGTATGA CATGTCGCCC TTCCACTTTG ACATCTTGTC ACTAAGTAAG
CATCAATTAT ACACCCCATT AAATTGATAA TGACATTCAA AAAGTGGGAT TAGACTATAT TCATCACCAT CATAATGAGC
AAACCAGACA AGTGGATGGT GAAAAAAACA ATGCAAATTT GTCATGCTGT GGAAAATCTA CTTGGACCTA ACATAAAAAA
GCTAGAGGCT AACTGATCCA TCCATTAACA TTAAGAAAAA GACATACATA TGTAAAAGAT AAATAGATAA TTTTATCTGA
TCTTCCGAGA AAGCTCTAGT TAGCCTGGAT GGTTCTGTAT ATGAGAGATT ATATATGTAA TCTTGAGATG GTGACAACCT
AATTAATTAA TTAATTAACA AGCAAGCATC CAGGCTAATA AACCAGTGAC TGCTAATAAA CCAGAAGTAC TGTAGACAAT
GCCCATTGAG GTGTCCCTGA ACAATTTTCA GGTCTGGGTC TGCTGGCTCT CAAACACTAA TTAAGTCAGT AAAAAACACC
TTGTATGTCA TCGGAGATCA GATAATTAAT CTGATTATGG TAGCCGAATA TTATATGGCT CTGGTTCGTC TGCAACAATA
ATAATTTGGC TCCTAATTAA CTCTCAAGTT TCATGATCAA ATCCTGGAAT TCATACTGGG GATCGTCCAA AATATTTCCT
TCAGAGTGTC TGTCATGCCG GTGTCTTCTT CCATAATTTT TTTTAGTTAC AAGTGTTTGT GTCGTGGAAG CAATTGAAAG
TTGTTGATCA GAGATTCAGA GACCTGATGG GTAATTTATC TTAAGAAACA TGCAAATATC AGTCTAGCTA GTTGATTCAG
AATCGCCATG TGTGGTAGCT ATCGTGCAAG CGTGCAAATA GTTTAGTTTT TTAAGCTACG ATATGTTATT GTCATGTGAC
ATTTGGTAAT CTTTTTTTTT TCAATGATTT TCTTCGAAAC TAGACAACCA GTAGTTAGAC GTCAACGCTT TGGTTTTTAA
TTGCAACTAG AATATAAATA AATTAATTTA CTAATAATGA GGGTCCTGTA TATAGTATAA ATTATTTCCC TTGCTTGTTA
CGTGTGCAAT TAAGTATAAA TAAAGTAGCT AGATGCATTA TTATCGATCC ACATTATCCA CTTGGGTAGT AAGGCTACTT
CTCAGTTCTC ACAAGTGTAC TACATGCGAC TATGTGAGAA TCTCTGAATA TTATTGTCCC TTTCCCTCTA GTCAAACCCT
TGTTTTACAA TTTATTCTTA CAATTTGTGT TCAGAATACT AATTTAATAG GGCTACCATA ATATGTACTT TTAGCACTTT
TTTCCTTTAA AAGTACAATA GTATATATCG ATATATACGA CCATATCAGT TGACAAGTTA TTTTTGCTCT TTTAAAATAC
AATAAGATGT TCTATTATAC AATCATACGG GTTAACGGAT CTTTTCCCTT TATTTGCAGG CAAGACATTC GAAACCCGTG
ACCCGCGCAC CGGCGAGGTC ATCGCCAAGA TCGCCGAAGG AGACAAGGCC GACATCGACC TCGCCGTGAA GGCCGCCAGG
GAGGCCTTCG ACCATGGCCC CTGGCCAAGA ATGTCCGGCT TTGTAAGCGC GCCTCTCTCC ACCATCGCCC GAAACCCGTA
AACGGGTTGG ATCCAAACCC GTTAGTTAAT AATACCAGGC GGCCCATCTA GTTATACCGC ACTAATTGGG CCTAATTAAG
CCCAGCTTAA CTTTGAATTT TTGGCGCCAA TTAATGGCTG CAGGCGAGGG GAAGGATCCT GCACAAGTTC GCGGACCTGG
TGGAGCAGCA CGTGGAGGAG CTGGCGGCGC TGGACACGGT GGACGCCGGC AAGCTGTTCG CGATGGGGAA GCTCGTCGAC
ATCCCCGGCG GCGCGAACCT GCTCCGGTAC TACGCCGGCG CGGCGGACAA GGTGCACGGC GAGACGCTCA AGATGGCGCG
GCCATGCCAC GGGTACACGC TCAAGGAGCC CGTCGGCGTC GTCGGCCACA TCGTGCCGTG GAACTACCCC ACCACCATGT
TCTTCTTCAA GGCCagcccg gcgctcgccg ccggctgcac catggtcgtc aagcccgccg agcagacccc cctctccgcg
cTCTTCTACG CCCACCTCGC CAAGCTTGCC GGCGTCCCCG ACGGCGTGCT CAACGTCGTC CCCGGCTTCG GCCCCACCGC
CGGCGCCGCT ATCTCCTCCC ACATGGACAT TGACAAGGTC AGATTACCTA CTTGCCATTA TGAATTTCTG AATTCCGATT
GATTATGCTT TTTTTTTAGA TAATGGATTA TATTAACCCG GCCTCTACAC CTTAGAAGGT GTACACAGCC CAAACCACAA
TCAAGAGTAC ATAAGACTCC ATCTATTACA CGAGGATACC AAATAAAAGT TTAACAAAAC GGTTAAAGAA GAACAACAGT
CTAAGCCTGA TGGTTTTCAC TTTTCAGGTG AGCTTCACCG GCTCGACGGA GGTCGGCCGG CTGGTGATGG AGGCGGCGGC
GAAGAGCAAC CTGAAGCCCG TCTCGCTCGA GCTGGGTGGC AAGTCTCCGG TCATCGTGTT CGACGACGCC GACCTCGACA
CGGCCGTGAA CCTGGTCCAC ATGGCCTCCT ACACCAACAA GGTCGGCCTC TCACCGGCCA TGTCGTCAGA AAACCATCTA
GCTGGCATAA GCACAACATA TTGTGAAAAT CTCATCAGCT TTCCACAACA ATCCTGTTCT GTTGCAGGGT GAGATCTGCG
TCGCCGGCTC GCGAATCTAT GTCCAGGAGG GGATCTACGA TGCGTTCGTG AAGAAGGCGA CCGAGATGGC CAAGAAATCG
GTGGTCGGAG ATCCGTTCAA CCCGCGAGTT CATCAAGGCC CTCAGGTATA TATATATGCT AGATCAGTAA CCATGCTCTG
ATTTTTCAAC TATACAAACT TCAGATTCAG AGAACCAAAG ATGTTCAGCA AGCTGTAATA ACCACTTGTG TGCAATTACA
ACGAAGATTG ACAAGGAGCA ATACGAGAAG ATCCTCAAGT ACATCGACAT CGGTAAGCGC GAAGGCGCGA CGTTGGTCAC
CGGAGGGAAG CCCTGCGGCG AAAACGGGTA CTACATCGAG CCCACCATCT TCACGGACGT CAAGGCATGA ACATGACCAG
TGTGCTCTTC ACTCCTCAGT GCTAAAATAT GACCAGCAGC ATTTTCAAAG AGAACAAAAA TGCACATTTC CAAATCGTGC
GAAAAACTAA TAGACCCCTT TTGCGCAGGA AGAAATGTCG ATCGCGCAAG AGGAAATCTT CGGGCCGGTG ATGGCCCTCA
TGAAATTCAA GTAGGCATCT TTTTCTGAAC ATTTCCAGCC TGACTAACAT CACATGAACA TCTAACTGAA AGCCTGAAAC
CACTGGATCC TGAACATTTT TGCACAGGAC GGTTGAGGAG GCGATCCAGA AGGCGAACAG CACCCGGTAC GGCCTGGCTG
CCGGCATAGT CACCAAGAAC ATCGACGTCG CGAACACGGT TTCGCGGTCG ATCCGGGCAG GGGCAATCTG GATCAATTGC
TACCTCGGCT TCGACCCCGA CGTGCCGTTC GGGGGGTACA AGATGAGCGG CTTCGGCAAG GACATGGGCA TGGACGCCCT
TGAGAAGTAC CTCCACACCA AGGCGGTGGT CACCCCTCTC TACAACACCC CTTGGCTATG ATCTGATGAT GAACAGCACA
GAAAGATTAA TTACAGTGGA AAAAAATAAC ATTTCTATAT ATACAGCTGA AAGGTTGGGT TATATTTGTG GTTAGTTGAT
TGCTTGTATC AAATATCAAT TTGTCGGAAT AAAGACAGTA TATTTCAGTT TCTCGGTGTG TTTTTCTTTG TCTGATGATC
TGACGTAAAC CCATAAGAAA AAGGTTAATG ACAGTATACT ATCAAACGCT 

Locus: Os01g0591000

Loading...

Locus: Os01g0591000

Loading...